Lus10001899 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G23820 154 / 3e-45 Pectin lyase-like superfamily protein (.1)
AT5G41870 135 / 3e-38 Pectin lyase-like superfamily protein (.1)
AT3G62110 133 / 5e-37 Pectin lyase-like superfamily protein (.1)
AT4G33440 120 / 3e-32 Pectin lyase-like superfamily protein (.1)
AT4G23500 116 / 1e-30 Pectin lyase-like superfamily protein (.1)
AT3G48950 113 / 9e-30 Pectin lyase-like superfamily protein (.1)
AT2G23900 108 / 8e-28 Pectin lyase-like superfamily protein (.1)
AT3G61490 105 / 9e-27 Pectin lyase-like superfamily protein (.1.2.3)
AT3G42950 99 / 1e-24 Pectin lyase-like superfamily protein (.1)
AT1G19170 99 / 2e-24 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003890 189 / 1e-58 AT4G23820 657 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10032374 173 / 2e-52 AT4G23820 656 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10023101 163 / 1e-48 AT4G23820 642 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10038030 131 / 2e-36 AT3G62110 632 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10009972 125 / 7e-35 AT3G62110 446 / 2e-156 Pectin lyase-like superfamily protein (.1)
Lus10014799 122 / 6e-33 AT4G33440 630 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10003589 121 / 2e-32 AT4G33440 649 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10007922 111 / 4e-29 AT3G61490 743 / 0.0 Pectin lyase-like superfamily protein (.1.2.3)
Lus10039279 106 / 5e-27 AT3G48950 624 / 0.0 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G139100 167 / 4e-50 AT4G23820 660 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.002G186900 130 / 3e-36 AT3G62110 666 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.014G112100 126 / 1e-34 AT3G62110 649 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.005G063400 122 / 4e-33 AT4G33440 652 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.007G105800 119 / 6e-32 AT4G33440 642 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.001G100000 109 / 2e-28 AT4G23500 701 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.017G145900 109 / 2e-28 AT3G48950 659 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.003G131700 107 / 9e-28 AT3G61490 688 / 0.0 Pectin lyase-like superfamily protein (.1.2.3)
Potri.008G211500 106 / 2e-27 AT3G16850 509 / 2e-179 Pectin lyase-like superfamily protein (.1)
Potri.002G162400 106 / 2e-27 AT3G61490 734 / 0.0 Pectin lyase-like superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10001899 pacid=23157114 polypeptide=Lus10001899 locus=Lus10001899.g ID=Lus10001899.BGIv1.0 annot-version=v1.0
ATGACTCTTTACTTGGCTAGAGGAGCCACCATTAAAGACACTCAGTTGTGGTCGATATTTGCTACTACAGGAAACGTGGAACTTTTAGTTGCTCCTTTAC
CGTTGTATGGACGGGGAGAGAGCTCCATGGTGGAAGGTGAGAATGGCACAATTAATGGGCAAGGAGGTGTTTGGTGGGATATGTGGAGGCAGAGAACTGT
TCAATATACAAGACCGAGTCTGGTCGATTTGATAAACTCGAAAGGCATTATCATATCAAATGTGATTTTCAAGAATTCTCCCTTTTGGAAAATTCACCCT
GTTTATAGCAGTCACATTGTAATACGATATGTGACCATCTTGGCTCCCCACGACTCACCTAATACTGATGGAGTCGATCCAGGTAAATTCTCCATTACTG
GTCTATGGTCTATGGACATTAAAAAAAATGGATTACACTTGAAGGCGAGTTTAAAGATAAACTCGGTAAAATCGAGGTCGTATTCATTGGTTTCGTTTCG
AGTATTACTTCGGAAAGTGTGA
AA sequence
>Lus10001899 pacid=23157114 polypeptide=Lus10001899 locus=Lus10001899.g ID=Lus10001899.BGIv1.0 annot-version=v1.0
MTLYLARGATIKDTQLWSIFATTGNVELLVAPLPLYGRGESSMVEGENGTINGQGGVWWDMWRQRTVQYTRPSLVDLINSKGIIISNVIFKNSPFWKIHP
VYSSHIVIRYVTILAPHDSPNTDGVDPGKFSITGLWSMDIKKNGLHLKASLKINSVKSRSYSLVSFRVLLRKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23820 Pectin lyase-like superfamily ... Lus10001899 0 1
AT4G02290 ATGH9B13 glycosyl hydrolase 9B13 (.1) Lus10010307 1.7 0.9063
AT4G39050 Kinesin motor family protein (... Lus10028790 2.8 0.8617
AT5G14450 GDSL-like Lipase/Acylhydrolase... Lus10014592 4.9 0.8151
AT1G64390 ATGH9C2 glycosyl hydrolase 9C2 (.1) Lus10033957 8.2 0.8130
AT1G74160 unknown protein Lus10034677 9.2 0.8027
AT1G70300 KUP6 K+ uptake permease 6, K+ uptak... Lus10012992 11.1 0.7449
AT1G77020 DNAJ heat shock N-terminal dom... Lus10042774 12.2 0.7756
AT1G77580 Plant protein of unknown funct... Lus10025674 12.3 0.7524
AT1G66150 TMK1 transmembrane kinase 1 (.1) Lus10039038 12.6 0.8118
AT1G77020 DNAJ heat shock N-terminal dom... Lus10029744 15.2 0.7686

Lus10001899 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.