Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32583 157 / 5e-50 unknown protein AT4G24972 121 / 5e-36 TPD1 tapetum determinant 1 (.1) AT1G05835 46 / 3e-07 PHD finger protein (.1) AT4G32110 38 / 0.0004 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016744 [exp] 127 / 7e-38 AT4G24972 172 / 5e-55 tapetum determinant 1 (.1) Lus10022437 [exp] 128 / 1e-35 AT5G51140 505 / 1e-177 Pseudouridine synthase family protein (.1.2) Lus10026289 [exp] 61 / 2e-12 AT4G32090 72 / 5e-17 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10042384 [exp] 56 / 9e-11 AT4G32110 81 / 1e-20 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10012177 [exp] 50 / 8e-09 AT4G32090 66 / 6e-15 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10007569 [exp] 45 / 9e-07 AT4G32110 64 / 2e-14 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G017600 [exp] 150 / 4e-47 AT1G32583 187 / 5e-61 unknown protein Potri.012G102900 [exp] 132 / 3e-40 AT1G32583 160 / 2e-50 unknown protein Potri.015G101000 [exp] 132 / 3e-40 AT1G32583 157 / 5e-49 unknown protein Potri.008G105600 [exp] 105 / 1e-29 AT4G24972 106 / 2e-29 tapetum determinant 1 (.1) Potri.010G246900 [exp] 87 / 4e-23 AT1G32583 104 / 3e-29 unknown protein Potri.010G246300 [exp] 76 / 2e-18 AT1G32583 85 / 1e-21 unknown protein Potri.010G145501 [exp] 64 / 5e-14 AT1G32583 74 / 1e-17 unknown protein Potri.002G233000 [exp] 50 / 8e-09 AT1G05835 111 / 2e-32 PHD finger protein (.1) Potri.004G167900 [exp] 44 / 2e-06 AT4G32090 117 / 7e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.006G257600 [exp] 42 / 1e-05 AT4G32105 77 / 4e-19 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001911 pacid=23157110 polypeptide=Lus10001911 locus=Lus10001911.g ID=Lus10001911.BGIv1.0 annot-version=v1.0 ATGGAAAACCGCACCAGTACTCCTATTACTACTGAAGACGATGAGGACTATGGCGGTGGGCAGAACAGGATAGGAGGAGAATGCTCCAAGGAAGACATAG TAATCTACCAAGGCTCATCGGCTCCCTTGGCCAACGGCATCCCAGCATTCTCCGTCCAGATCCTTAACGCTGGCGTATCTGCAGGATGCTGCATTGTCAA CATCCACGTTAGCTGCGGCTGGTTCAGCTCATACAGGGTCGTTAACCCAACTGTATTCCGCCGTCTCAACTATGACGACTGCCTCGTCAACAATGGTCAG CCCCTCGCTCCCAGCTCCTCCCTCTACTTCGAGTATGCCAACAGTTTCCGCTACCCTCTCTCTGTTTCATCCTGTTGA
AA sequence Show only first row Show all	>Lus10001911 pacid=23157110 polypeptide=Lus10001911 locus=Lus10001911.g ID=Lus10001911.BGIv1.0 annot-version=v1.0 MENRTSTPITTEDDEDYGGGQNRIGGECSKEDIVIYQGSSAPLANGIPAFSVQILNAGVSAGCCIVNIHVSCGWFSSYRVVNPTVFRRLNYDDCLVNNGQ PLAPSSSLYFEYANSFRYPLSVSSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G32583			unknown protein		Lus10001911 [exp]	0	1
AT3G55240			Plant protein 1589 of unknown ...		Lus10003293 [exp]	1.7	0.8814
AT4G38380			MATE efflux family protein (.1...		Lus10020203 [exp]	4.5	0.8790
AT3G49250		IDN1, DMS3	INVOLVED IN DE NOVO 1, defecti...		Lus10030244 [exp]	7.7	0.8386
AT4G15620			Uncharacterised protein family...		Lus10041528 [exp]	7.8	0.8886
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10029575 [exp]	10.0	0.8841
AT3G14470			NB-ARC domain-containing disea...		Lus10022900 [exp]	15.7	0.8203
AT5G65120			unknown protein		Lus10000581 [exp]	15.9	0.8407
AT5G18880			RNA-directed DNA polymerase (r...		Lus10023044 [exp]	18.7	0.8599
AT2G26580	YABBY	YAB5	YABBY5, plant-specific transcr...		Lus10019407 [exp]	20.1	0.8674
AT4G18540			unknown protein		Lus10036092 [exp]	20.8	0.8598

Compare expression of checked genes

Lus10001911 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.