Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G34940 81 / 4e-19 ATGUS3 glucuronidase 3 (.1.2.3) AT5G61250 64 / 6e-13 ATGUS1 glucuronidase 1 (.1.2) AT5G07830 60 / 2e-11 ATGUS2 glucuronidase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023219 [exp] 100 / 2e-27 AT5G34940 51 / 1e-07 glucuronidase 3 (.1.2.3) Lus10038109 [exp] 74 / 4e-16 AT5G34940 678 / 0.0 glucuronidase 3 (.1.2.3) Lus10008823 [exp] 72 / 1e-15 AT5G34940 677 / 0.0 glucuronidase 3 (.1.2.3) Lus10008038 [exp] 71 / 2e-15 AT5G34940 671 / 0.0 glucuronidase 3 (.1.2.3) Lus10004664 [exp] 64 / 8e-13 AT5G07830 519 / 0.0 glucuronidase 2 (.1) Lus10036962 [exp] 62 / 3e-12 AT5G61250 501 / 8e-174 glucuronidase 1 (.1.2) Lus10001952 [exp] 62 / 4e-12 AT5G34940 149 / 9e-42 glucuronidase 3 (.1.2.3) Lus10037110 [exp] 61 / 1e-11 AT5G07830 528 / 0.0 glucuronidase 2 (.1) Lus10037109 [exp] 60 / 2e-11 AT5G61250 503 / 7e-175 glucuronidase 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G024200 [exp] 102 / 2e-26 AT5G34940 664 / 0.0 glucuronidase 3 (.1.2.3) Potri.006G062200 [exp] 81 / 1e-18 AT5G34940 729 / 0.0 glucuronidase 3 (.1.2.3) Potri.018G121500 [exp] 76 / 3e-17 AT5G34940 734 / 0.0 glucuronidase 3 (.1.2.3) Potri.010G160800 [exp] 60 / 2e-11 AT5G61250 561 / 0.0 glucuronidase 1 (.1.2) Potri.015G049100 [exp] 59 / 3e-11 AT5G07830 731 / 0.0 glucuronidase 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001922 pacid=23175276 polypeptide=Lus10001922 locus=Lus10001922.g ID=Lus10001922.BGIv1.0 annot-version=v1.0 ATGAGGAGATCGGGTTCCAAGGTCGATGCAACTTCAAGAAAGGAATATCATTTAACTGCTAACGGTGGCGATTTACACAGCCAGACTGTACTTTTGAACG GGAAAGTATTAGCTATGGATACTTCTACCGGAACTATACCTCAGTTGGAACCTGTTCAGGCCAGACTATCGGACCCGATAACTGTTGCTCCGTTCTCTAT CGTGTTCGTAAGCATTTCCAACATGACAATTCCAGCCTCGCCAGAATCAGATGAAGCAGGGATGAGTCGATTCCTCGGCGGCGGAGAAGGGGTATCGAGG GGAAAAAAACCACAGAACAAGCAGCTGAAACATTGGCGCGTGCAAACTAACCTCGCGAGTGAATGA
AA sequence Show only first row Show all	>Lus10001922 pacid=23175276 polypeptide=Lus10001922 locus=Lus10001922.g ID=Lus10001922.BGIv1.0 annot-version=v1.0 MRRSGSKVDATSRKEYHLTANGGDLHSQTVLLNGKVLAMDTSTGTIPQLEPVQARLSDPITVAPFSIVFVSISNMTIPASPESDEAGMSRFLGGGEGVSR GKKPQNKQLKHWRVQTNLASE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G34940		ATGUS3	glucuronidase 3 (.1.2.3)		Lus10001922 [exp]	0	1
AT1G55200			Protein kinase protein with ad...		Lus10036100 [exp]	1.0	0.9211
					Lus10019353 [exp]	1.4	0.9127
AT4G26310			elongation factor P (EF-P) fam...		Lus10007884 [exp]	4.2	0.9098
AT4G04350		EMB2369	EMBRYO DEFECTIVE 2369, tRNA sy...		Lus10020034 [exp]	5.3	0.8727
AT5G43290	WRKY	ATWRKY49, WRKY4...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10010851 [exp]	7.9	0.8939
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Lus10027353 [exp]	8.8	0.8917
AT1G61560		ATMLO6, MLO6	MILDEW RESISTANCE LOCUS O 6, S...		Lus10012410 [exp]	12.0	0.8793
AT3G46590		ATTRP2, TRFL1	TRF-like 1 (.1.2.3)		Lus10016527 [exp]	14.3	0.9005
AT1G11330			S-locus lectin protein kinase ...		Lus10015422 [exp]	14.7	0.8904
AT3G16230			Predicted eukaryotic LigT (.1....		Lus10006828 [exp]	14.8	0.9057

Compare expression of checked genes

Lus10001922 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.