Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25250 87 / 8e-22 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) AT5G25260 86 / 3e-21 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) AT5G64870 81 / 2e-19 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G258900 [exp] 113 / 5e-31 AT5G25260 704 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.018G022900 [exp] 112 / 6e-31 AT5G25260 703 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001944 pacid=23182259 polypeptide=Lus10001944 locus=Lus10001944.g ID=Lus10001944.BGIv1.0 annot-version=v1.0 ATGGCAGCGGTCAGAGCATCGTTCTACAACAACCAACAAATGGCCGAGGCTAGGCTTTTTGGTAAGCTGAAGGAGGCTGAAGGACTTGTAGCCATCGCCA AAGCACAAGGGACTTATTTGAAGACACTCCTCGACACGCTTGGTGGGAACTGCACTTCCTTGAGGGATTACTTGATGATCAACGGCGACATGTACCAATC ATTGGCACAGATCAATGCCGACGTGCTGCGTGGGATGCAACCAAAGCTTAGCATATAG
AA sequence Show only first row Show all	>Lus10001944 pacid=23182259 polypeptide=Lus10001944 locus=Lus10001944.g ID=Lus10001944.BGIv1.0 annot-version=v1.0 MAAVRASFYNNQQMAEARLFGKLKEAEGLVAIAKAQGTYLKTLLDTLGGNCTSLRDYLMINGDMYQSLAQINADVLRGMQPKLSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25250			SPFH/Band 7/PHB domain-contain...		Lus10001944 [exp]	0	1
					Lus10021453 [exp]	2.6	0.8881
					Lus10015310 [exp]	3.2	0.8803
					Lus10006584 [exp]	3.5	0.7758
AT4G36950		MAPKKK21	mitogen-activated protein kina...		Lus10034246 [exp]	4.9	0.8648
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10031125 [exp]	5.7	0.7149
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10016892 [exp]	7.3	0.8541
AT3G45070			P-loop containing nucleoside t...		Lus10003068 [exp]	7.7	0.8567
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10038525 [exp]	8.0	0.8045
AT5G19730			Pectin lyase-like superfamily ...		Lus10034981 [exp]	10.5	0.8554
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10032446 [exp]	10.6	0.8067

Compare expression of checked genes

Lus10001944 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.