Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42785 62 / 1e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002541 [exp] 179 / 1e-59 AT5G42785 46 / 3e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G228800 [exp] 69 / 2e-16 AT5G42785 56 / 2e-11 unknown protein Potri.002G034300 [exp] 68 / 5e-16 AT5G42785 59 / 2e-12 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001961 pacid=23170267 polypeptide=Lus10001961 locus=Lus10001961.g ID=Lus10001961.BGIv1.0 annot-version=v1.0 ATGGGGGACAGAACTTTCGTTGTGATTTTCTTTTTCTGGGCTGCCCTCACAATCATCACCCCGATGCTGATTCTCCTCTCGGAATCTTCCAAACCCAGCA CTTTGGTTTCCCAAGATGTAATGCAAAGTACTGAAGCACTTACTCCGAGGAAAATGATGGGATATGCAGAGAAGAAATGGAACATGAGTACAACTTCAGC AGCAGCAGCAAGGAATGTTTCAGCAGGACCAACTGAAGCTCCACAGCCTTCCTCTGAACCTGATGATCATAATCCCAAGACCGCTGATACTGTTGTTGAC GTATGGGGTTGA
AA sequence Show only first row Show all	>Lus10001961 pacid=23170267 polypeptide=Lus10001961 locus=Lus10001961.g ID=Lus10001961.BGIv1.0 annot-version=v1.0 MGDRTFVVIFFFWAALTIITPMLILLSESSKPSTLVSQDVMQSTEALTPRKMMGYAEKKWNMSTTSAAAARNVSAGPTEAPQPSSEPDDHNPKTADTVVD VWG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42785			unknown protein		Lus10001961 [exp]	0	1
AT4G01470		ATTIP1.3, GAMMA...	tonoplast intrinsic protein 1;...		Lus10040863 [exp]	3.2	0.9010
AT3G59440			Calcium-binding EF-hand family...		Lus10020171 [exp]	3.7	0.8911
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10034666 [exp]	5.3	0.8776
AT5G42785			unknown protein		Lus10002541 [exp]	10.4	0.8873
AT5G65030			unknown protein		Lus10024055 [exp]	12.2	0.7628
AT3G29000			Calcium-binding EF-hand family...		Lus10026974 [exp]	13.0	0.8528
AT4G33880	bHLH	RSL2, bHLH085	ROOT HAIR DEFECTIVE 6-LIKE 2 (...		Lus10001068 [exp]	13.9	0.8330
AT5G14340	MYB	AtMYB40	myb domain protein 40 (.1)		Lus10032117 [exp]	16.0	0.8695
AT1G50650			Stigma-specific Stig1 family p...		Lus10006512 [exp]	16.7	0.8644
AT2G37460			nodulin MtN21 /EamA-like trans...		Lus10007696 [exp]	17.9	0.8625

Compare expression of checked genes

Lus10001961 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.