Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55090 74 / 2e-16 ABCG16 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) AT2G39350 69 / 1e-14 ABCG1 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) AT3G55130 50 / 3e-08 ABCG19, ATWBC19 ATP-binding cassette G19, white-brown complex homolog 19 (.1) AT3G55110 48 / 2e-07 ABCG18 ATP-binding cassette G18, ABC-2 type transporter family protein (.1) AT5G13580 40 / 9e-05 ABCG6 ATP-binding cassette G6, ABC-2 type transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030307 [exp] 174 / 4e-55 AT2G37360 366 / 9e-122 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10040341 [exp] 155 / 2e-45 AT2G39350 452 / 0.0 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) Lus10023465 [exp] 153 / 2e-44 AT2G39350 1064 / 0.0 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) Lus10025150 [exp] 103 / 5e-30 AT3G55090 54 / 9e-10 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Lus10025281 [exp] 51 / 2e-08 AT2G37360 1035 / 0.0 ATP-binding cassette G2, ABC-2 type transporter family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G047900 [exp] 121 / 5e-33 AT3G55090 1008 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Potri.010G213400 [exp] 118 / 4e-32 AT3G55090 1014 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Potri.014G080200 [exp] 74 / 2e-16 AT2G37360 955 / 0.0 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Potri.002G156900 [exp] 74 / 3e-16 AT3G53510 950 / 0.0 ATP-binding cassette G20, ABC-2 type transporter family protein (.1) Potri.006G215100 [exp] 69 / 1e-14 AT3G53510 860 / 0.0 ATP-binding cassette G20, ABC-2 type transporter family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001971 pacid=23140503 polypeptide=Lus10001971 locus=Lus10001971.g ID=Lus10001971.BGIv1.0 annot-version=v1.0 ATGGACCTCACTCGCGATCAACCGTCTCCGGTACGACGCGCCGCCTTCGGCCTGTCCCCTACTCTGGGACAGCTTCTCAAGCGTGTCGGAGATGTCCGCA AGGAAGCTACCGGCGACGGTAGTGAAACTCCCGAACACCAGGTCCTCGAGCTCGGAGATTCCCGCCCGGAGGTTCCCCGCGCCATCCCCTTCGTCCTCTC CTTCAACAACCTCACTTACAGCGTCCGAGTCCGCCGCAAGCTGAGGCTTCCGGACATGCTCCCCGTCCGCCGGATCAATCGCCTCGGACAGGCTGCTACC GCCGCCGAGCGCGCGGCCGGCGGGGCGCGGGGGGGTGTCGCCAGTTTAATTTAA
AA sequence Show only first row Show all	>Lus10001971 pacid=23140503 polypeptide=Lus10001971 locus=Lus10001971.g ID=Lus10001971.BGIv1.0 annot-version=v1.0 MDLTRDQPSPVRRAAFGLSPTLGQLLKRVGDVRKEATGDGSETPEHQVLELGDSRPEVPRAIPFVLSFNNLTYSVRVRRKLRLPDMLPVRRINRLGQAAT AAERAAGGARGGVASLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G55090		ABCG16	ATP-binding cassette G16, ABC-...		Lus10001971 [exp]	0	1
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10040341 [exp]	3.9	0.9196
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10023465 [exp]	4.4	0.9295
AT2G18360			alpha/beta-Hydrolases superfam...		Lus10041747 [exp]	6.5	0.9286
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10042611 [exp]	11.4	0.8912
AT5G13580		ABCG6	ATP-binding cassette G6, ABC-2...		Lus10001972 [exp]	12.2	0.9130
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022065 [exp]	13.5	0.8867
AT5G09530		PRP10, PELPK1	proline-rich protein 10, Pro-G...		Lus10033357 [exp]	13.6	0.8888
AT1G74460			GDSL-like Lipase/Acylhydrolase...		Lus10034459 [exp]	16.7	0.8808
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10010575 [exp]	19.7	0.8802
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10006909 [exp]	20.0	0.8664

Compare expression of checked genes

Lus10001971 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.