Lus10001985 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G45210 92 / 5e-24 SAUR-like auxin-responsive protein family (.1)
AT3G60690 83 / 1e-20 SAUR-like auxin-responsive protein family (.1)
AT4G22620 72 / 3e-16 SAUR-like auxin-responsive protein family (.1)
AT2G21210 60 / 3e-12 SAUR-like auxin-responsive protein family (.1)
AT4G12410 61 / 4e-12 SAUR-like auxin-responsive protein family (.1)
AT4G00880 59 / 1e-11 SAUR-like auxin-responsive protein family (.1)
AT2G46690 56 / 1e-10 SAUR-like auxin-responsive protein family (.1)
AT4G34800 54 / 3e-10 SAUR-like auxin-responsive protein family (.1)
AT4G38840 54 / 4e-10 SAUR-like auxin-responsive protein family (.1)
AT4G34810 54 / 5e-10 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030295 222 / 3e-75 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1)
Lus10009286 107 / 1e-29 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Lus10015879 100 / 9e-27 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1)
Lus10032237 64 / 6e-13 AT4G12410 149 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Lus10024600 64 / 7e-13 AT4G12410 149 / 3e-46 SAUR-like auxin-responsive protein family (.1)
Lus10012182 62 / 8e-13 AT4G34800 86 / 1e-22 SAUR-like auxin-responsive protein family (.1)
Lus10010110 62 / 1e-12 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1)
Lus10007563 62 / 1e-12 AT4G34800 87 / 2e-23 SAUR-like auxin-responsive protein family (.1)
Lus10004337 60 / 1e-11 AT4G12410 110 / 2e-31 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G066900 100 / 2e-27 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1)
Potri.002G145300 89 / 1e-22 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1)
Potri.003G113100 73 / 2e-16 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1)
Potri.001G119900 63 / 9e-13 AT4G12410 140 / 8e-43 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 59 / 1e-11 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.002G176400 58 / 2e-11 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 58 / 2e-11 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 57 / 3e-11 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.009G126500 54 / 3e-10 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 54 / 5e-10 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10001985 pacid=23140515 polypeptide=Lus10001985 locus=Lus10001985.g ID=Lus10001985.BGIv1.0 annot-version=v1.0
ATGAGAAAGTTCAGGGGATTCAGATTAAGCAAGGGAATTATCCGATTAACCAACTGGGTCTTCAGCCAGAGGCAACAGAGGAACCGATCCCTCTACAACC
GCCTCATTTCCGGCGGCGACGGCGGCAGCGATTCCCCAAGGCCGATTACTAACAGGATCAGAAAGTGGGGCCTCCGATTAGCCCAATCGATTCGCAACCC
GAGCCGCAGGTTCGGTTCTGGTTATGAACCGGTTCCGGTTCCGAAGGGTCAACTGGCGGTATACGTCGGTCAAAAGGGTGACGGCGGCGATGTGTGTCGG
AGGGTGTTGGTTCCGGTGATATACATTAATCATCCTCTGTTCGGCGAGCTGCTGAAGGGAGCACAGGAAGAGTACGGTTTCGGTCACCGCCGGCAGTTCT
TCCCGGCGGCGGTGATGATGACGATGACGATAAAGATTTTAGTGTTCTGTTTCCGGATTTCTCGCAATTGTACAAGGGATGTGTAA
AA sequence
>Lus10001985 pacid=23140515 polypeptide=Lus10001985 locus=Lus10001985.g ID=Lus10001985.BGIv1.0 annot-version=v1.0
MRKFRGFRLSKGIIRLTNWVFSQRQQRNRSLYNRLISGGDGGSDSPRPITNRIRKWGLRLAQSIRNPSRRFGSGYEPVPVPKGQLAVYVGQKGDGGDVCR
RVLVPVIYINHPLFGELLKGAQEEYGFGHRRQFFPAAVMMTMTIKILVFCFRISRNCTRDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G45210 SAUR-like auxin-responsive pro... Lus10001985 0 1
AT5G40470 RNI-like superfamily protein (... Lus10022269 1.0 0.9141
AT3G22750 Protein kinase superfamily pro... Lus10042622 2.8 0.8464
AT1G22170 Phosphoglycerate mutase family... Lus10033465 3.0 0.8551
AT1G35830 VQ motif-containing protein (.... Lus10024738 5.5 0.8756
AT1G11050 Protein kinase superfamily pro... Lus10012701 9.4 0.8353
AT1G62990 HD IXR11, KNAT7 KNOTTED-like homeobox of Arabi... Lus10024485 11.5 0.8169
AT1G11050 Protein kinase superfamily pro... Lus10001295 11.6 0.8452
AT1G66230 MYB ATMYB20 myb domain protein 20 (.1) Lus10027197 12.0 0.8406
AT5G11730 Core-2/I-branching beta-1,6-N-... Lus10007457 12.4 0.8246
AT5G58320 Kinase interacting (KIP1-like)... Lus10019111 14.8 0.8239

Lus10001985 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.