Lus10001988 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G00080 150 / 2e-45 UNE11 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 126 / 3e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 113 / 5e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G12390 112 / 1e-30 PME1 pectin methylesterase inhibitor 1 (.1)
AT4G25260 108 / 3e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 101 / 1e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 93 / 3e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 92 / 4e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G20740 91 / 2e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 89 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030292 390 / 4e-140 AT4G00080 158 / 1e-48 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 122 / 2e-34 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 119 / 2e-33 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 110 / 6e-30 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 109 / 8e-30 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10032230 107 / 1e-28 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10024593 100 / 5e-26 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 84 / 6e-20 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 81 / 7e-19 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G145800 182 / 3e-58 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G067500 175 / 6e-55 AT4G00080 156 / 1e-47 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 117 / 8e-33 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 117 / 1e-32 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 114 / 2e-31 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.006G137800 102 / 1e-26 AT5G20740 205 / 2e-67 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 99 / 2e-25 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G132600 96 / 4e-24 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 90 / 2e-22 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 89 / 7e-22 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10001988 pacid=23140518 polypeptide=Lus10001988 locus=Lus10001988.g ID=Lus10001988.BGIv1.0 annot-version=v1.0
ATGGCGACCACCACCACCACCACCCATTTCCTCCCTCTCCTTTTCCTAATCCTCCTCACCCTCGCCGTCTCCGTAAACTCGAACCCCTCAACAGCATCCT
CGAACCCTTACATCGTTAAGCAATGCCAAACCACCAGATACCCATCCCTCTGCGTCCAGTGCTTCTCCACCTTCGCCAACTCAACCTCCCACCACTCCCC
ACAGCAGCTAGCCCGCATCGCCCTCACCGTAAGCCTCTACAAAGCCCGCCTCACCAGATCCTTCCTCCTCAAAGTCAACCGCAACCTCAAGGCGTTGACC
AAGCCACGTCACGACCGCCAAGTAATGAACGACTGCCTCGGCCAGCTGGCCGACGGCATCCAGCAGCTCAGCCGGTCCATCCTCGAGCTCGCCCAGCTCG
AGAAGAAAGGCGGTGTGGCCGTAAACGACGACGCCGTTTTGTGGCACGTGAGGAACGTGGAGACCTGGGTGAGCGCCGCCCAGACGGATGCCGACACGTG
CTTGGACGAGTTCCATGGGAAGAAGATGAGTAAGCTTAGGGCTACCATTAAGGTGAGGGTTACGAATGTTGCGGAAACTGCTAGTAATGCTCTGACTTTG
TTTCAGAGGTTCGTTGTTGCCAGGTTTGGCGCTCGGTTCGCCTCCAAGCGTTATCCGTGA
AA sequence
>Lus10001988 pacid=23140518 polypeptide=Lus10001988 locus=Lus10001988.g ID=Lus10001988.BGIv1.0 annot-version=v1.0
MATTTTTTHFLPLLFLILLTLAVSVNSNPSTASSNPYIVKQCQTTRYPSLCVQCFSTFANSTSHHSPQQLARIALTVSLYKARLTRSFLLKVNRNLKALT
KPRHDRQVMNDCLGQLADGIQQLSRSILELAQLEKKGGVAVNDDAVLWHVRNVETWVSAAQTDADTCLDEFHGKKMSKLRATIKVRVTNVAETASNALTL
FQRFVVARFGARFASKRYP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G00080 UNE11 unfertilized embryo sac 11, Pl... Lus10001988 0 1
AT5G35700 FIM2, FIM5 FIMBRIN5, fimbrin-like protein... Lus10012361 2.4 0.9450
AT5G59790 Domain of unknown function (DU... Lus10005887 5.2 0.9386
AT3G21710 unknown protein Lus10027176 5.7 0.9401
AT3G25600 Calcium-binding EF-hand family... Lus10017900 7.2 0.9253
AT5G54370 Late embryogenesis abundant (L... Lus10017577 7.7 0.9469
AT2G41560 ACA4 "autoinhibited Ca\(2+\)-ATPase... Lus10019758 10.2 0.8887
AT4G10350 NAC BRN2, NST4, ANA... BEARSKIN 2, NAC domain contain... Lus10013782 10.7 0.9415
AT5G54370 Late embryogenesis abundant (L... Lus10033540 10.7 0.9463
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10036147 11.4 0.8814
AT5G54370 Late embryogenesis abundant (L... Lus10026972 14.1 0.9432

Lus10001988 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.