Lus10001992 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10001992 pacid=23144307 polypeptide=Lus10001992 locus=Lus10001992.g ID=Lus10001992.BGIv1.0 annot-version=v1.0
ATGTCCAATTACTCAGAAAACTTCATGAACGTCTTTATGTCCGCAGATGAGGCATGCTTCTTCAAAGAGAGAAATTGGGATCATGAGAGAACTAACAAGT
TTACACCGTCGCTTAAACCAGAAGTTGATTGGCATGCTTCTTCCAAACAAGTCGGAAATTTCCCCGCAAGCATGAAAAAGCTGATACTTGTCTGGAAAGT
GCTGGACACAAGAAAAGTTCCCGACATACTTGCCAGTGCTATTTTCCTCTCAATAGTCTGCCGGTACGCTTCTTATAAGAAGGTTAATGCTGAGGGCTTT
ACTGTAGATAGTTGA
AA sequence
>Lus10001992 pacid=23144307 polypeptide=Lus10001992 locus=Lus10001992.g ID=Lus10001992.BGIv1.0 annot-version=v1.0
MSNYSENFMNVFMSADEACFFKERNWDHERTNKFTPSLKPEVDWHASSKQVGNFPASMKKLILVWKVLDTRKVPDILASAIFLSIVCRYASYKKVNAEGF
TVDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001992 0 1
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Lus10031590 1.0 0.8156
AT1G69550 disease resistance protein (TI... Lus10024150 2.8 0.7236
AT2G44525 Protein of unknown function (D... Lus10007558 4.0 0.6812
AT5G42250 Zinc-binding alcohol dehydroge... Lus10040457 8.1 0.7911
AT2G02950 PKS1 phytochrome kinase substrate 1... Lus10036746 10.4 0.7706
AT2G32750 Exostosin family protein (.1) Lus10010677 10.6 0.7241
AT1G52240 PIRF1, ATROPGEF... phytochrome interacting RopGEF... Lus10011443 13.1 0.7634
AT2G01150 RHA2B RING-H2 finger protein 2B (.1) Lus10003617 18.0 0.6896
AT4G18260 Cytochrome b561/ferric reducta... Lus10020757 20.0 0.6986
AT4G03140 NAD(P)-binding Rossmann-fold s... Lus10040909 22.0 0.7243

Lus10001992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.