Lus10001993 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000292 160 / 2e-51 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10001993 pacid=23144308 polypeptide=Lus10001993 locus=Lus10001993.g ID=Lus10001993.BGIv1.0 annot-version=v1.0
ATGAGACCACCACCAACTTGTTCTTTTTCTTCAGCTTCTTCATCCATTCTTACTAGTCCAGTATCCCTCCAAAGATTTCTTCCAAGCTCTATCATCAAGA
GATACAACAGCGGAGGGAGGAAAGACGGGAATCAAGAAGAAGAAGAAGAAAACGTAATAGCAGGAGATCATGTAAGGGCGCCATCTCTGGCAGATGAGTT
TAGGAGACTGGAGGCACAGAAATTGAAGGAAGATCACCATCTCCATGAAATTACTGATCGTGGTATAGCGAGTCAGACAGCGGGGAAAGCAATGGACGGA
TTAGATGATGCATTGGATAAGGAGGACAATAACCTGGAACCGGTGAAGAATAGATACAAGGAGCAGGAACCGGGTGCTGATTATCGGCGGAGAGGGACCA
ATACTAATCGTTACTAG
AA sequence
>Lus10001993 pacid=23144308 polypeptide=Lus10001993 locus=Lus10001993.g ID=Lus10001993.BGIv1.0 annot-version=v1.0
MRPPPTCSFSSASSSILTSPVSLQRFLPSSIIKRYNSGGRKDGNQEEEEENVIAGDHVRAPSLADEFRRLEAQKLKEDHHLHEITDRGIASQTAGKAMDG
LDDALDKEDNNLEPVKNRYKEQEPGADYRRRGTNTNRY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001993 0 1
AT5G16370 AAE5 acyl activating enzyme 5 (.1) Lus10013773 10.0 0.8587
AT5G47650 ATNUDX2, ATNUDT... ARABIDOPSIS THALIANA NUDIX HYD... Lus10012320 15.7 0.8513
AT4G07950 DNA-directed RNA polymerase, s... Lus10030228 19.7 0.8354
AT3G61430 ATPIP1, PIP1;1,... PLASMA MEMBRANE INTRINSIC PROT... Lus10040217 36.4 0.8212
Lus10038309 41.3 0.8139
AT3G62940 Cysteine proteinases superfami... Lus10005939 48.2 0.7925
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10006542 48.9 0.7987
AT4G17620 glycine-rich protein (.1.2.3) Lus10030023 95.3 0.7705
AT5G53900 Serine/threonine-protein kinas... Lus10005549 97.3 0.7780
AT3G03773 HSP20-like chaperones superfam... Lus10002623 102.4 0.7956

Lus10001993 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.