Plant FIBer expression Database

Lus10002016 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15370 253 / 5e-88 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002911
[exp]
298 / 7e-106 AT1G15370 253 / 7e-88 SNARE-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G193100
[exp]
246 / 2e-85 AT1G15370 263 / 7e-92 SNARE-like superfamily protein (.1)
Potri.006G253700
[exp]
213 / 3e-72 AT1G15370 197 / 4e-66 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Lus10002016 pacid=23166968 polypeptide=Lus10002016 locus=Lus10002016.g ID=Lus10002016.BGIv1.0 annot-version=v1.0
ATGTTGCTCGCAGTTCTGATCTCGAATTCGGTGGGCAATATTCTTGTAGAAAGATTCAATGGAGTTCCAGCTGAGGAGCGATTGCACTGGCGATCTTTCC
TGGTGAAACTGGGAGCTGACAATCTCAAGCACGCCAAGAACGAAGAGCTCTTCGTTGCTTCCCACAAGTCGGTTTATATAGTATATACGGTGCTGGGAGA
TATCTGCCTTTACGTTGTTGGCAAGGATGAATATGATGAACTAGCTTTGTCTGAAGCCATCTTTGTGATAACGGGGTCGATCAAGGATATCTGCAAGAAG
CCTCCTACGGAGCGGACTTTCCTCGATAAGTATGGGAAGATATGTCTTTCCCTCGACGAGATCGTCTGGAAGGGGATCCTGGAGAACACAGACAAAGACA
GGATCAAAAGGCTGATTAGATTGAAGCCTCCCACCGATGTTTGA
AA sequence
>Lus10002016 pacid=23166968 polypeptide=Lus10002016 locus=Lus10002016.g ID=Lus10002016.BGIv1.0 annot-version=v1.0
MLLAVLISNSVGNILVERFNGVPAEERLHWRSFLVKLGADNLKHAKNEELFVASHKSVYIVYTVLGDICLYVVGKDEYDELALSEAIFVITGSIKDICKK
PPTERTFLDKYGKICLSLDEIVWKGILENTDKDRIKRLIRLKPPTDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15370 SNARE-like superfamily protein... Lus10002016
[exp]
0 1
AT5G50460 secE/sec61-gamma protein trans... Lus10035206
[exp]
2.4 0.8386
AT1G04040 HAD superfamily, subfamily III... Lus10011774
[exp]
14.1 0.8470
AT5G03960 IQD12 IQ-domain 12 (.1) Lus10018031
[exp]
15.9 0.8683
AT4G15800 RALFL33 ralf-like 33 (.1) Lus10020647
[exp]
24.0 0.8002
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10032260
[exp]
24.4 0.8203
AT1G47480 alpha/beta-Hydrolases superfam... Lus10021745
[exp]
24.7 0.8374
AT3G58730 vacuolar ATP synthase subunit ... Lus10027271
[exp]
28.4 0.7529
AT4G14550 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic... Lus10018766
[exp]
29.3 0.8456
AT3G16850 Pectin lyase-like superfamily ... Lus10016837
[exp]
32.4 0.8455
AT1G12240 ATBETAFRUCT4, V... VACUOLAR INVERTASE, Glycosyl h... Lus10028922
[exp]
37.5 0.8149

Lus10002016 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.