Lus10002020 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G47650 89 / 3e-24 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002906 121 / 3e-37 AT3G47650 109 / 1e-31 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10019417 91 / 4e-25 AT3G47650 128 / 2e-38 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10043274 89 / 2e-24 AT3G47650 107 / 1e-30 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10005719 86 / 1e-23 AT3G47650 130 / 4e-40 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10030091 86 / 4e-23 AT3G47650 129 / 3e-39 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G028500 99 / 1e-28 AT3G47650 120 / 4e-36 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.018G068300 91 / 3e-25 AT3G47650 140 / 9e-44 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10002020 pacid=23166974 polypeptide=Lus10002020 locus=Lus10002020.g ID=Lus10002020.BGIv1.0 annot-version=v1.0
ATGGCTGCAGTGGCGAGCTCTAGTATGGCGCTCTCGAATCCATATCCAGGTGCTGTTCAGTGCTCGCAGTGCAAAGGCAATGGTGTAAACCCAGTCGATT
TCTTCAATGGACAGTTCAAAGCTGGCGATTCGTGTTGGCTTTGCGGGGGGAAGAAAGATATGTTATGTGGGAACTGCAATGGAGCTGGATTCCTTGGTGG
CTTTATCAGCACTGGTGATCAGTGA
AA sequence
>Lus10002020 pacid=23166974 polypeptide=Lus10002020 locus=Lus10002020.g ID=Lus10002020.BGIv1.0 annot-version=v1.0
MAAVASSSMALSNPYPGAVQCSQCKGNGVNPVDFFNGQFKAGDSCWLCGGKKDMLCGNCNGAGFLGGFISTGDQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10002020 0 1
AT4G22950 MADS AGL19 AGAMOUS-like 19 (.1) Lus10014143 2.4 0.9281
AT1G07700 Thioredoxin superfamily protei... Lus10032343 3.9 0.9417
AT1G12250 Pentapeptide repeat-containing... Lus10024602 4.0 0.9389
AT4G11880 MADS AGL14 AGAMOUS-like 14 (.1) Lus10014144 4.9 0.9069
AT4G37925 NdhM, NDH-M NADH dehydrogenase-like comple... Lus10042759 6.5 0.9146
AT1G64355 unknown protein Lus10001903 7.5 0.9066
AT1G49975 unknown protein Lus10006137 8.5 0.9196
AT5G19440 NAD(P)-binding Rossmann-fold s... Lus10026152 9.5 0.9092
AT1G04760 ATVAMP726 vesicle-associated membrane pr... Lus10043133 10.0 0.8442
AT5G16660 unknown protein Lus10026866 10.1 0.8826

Lus10002020 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.