Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11630 80 / 3e-21 unknown protein AT4G17310 56 / 2e-11 unknown protein AT5G47455 48 / 2e-08 unknown protein AT4G39300 39 / 3e-05 unknown protein AT4G32900 37 / 0.0005 Peptidyl-tRNA hydrolase II (PTH2) family protein (.1), Peptidyl-tRNA hydrolase II (PTH2) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011623 [exp] 96 / 1e-27 AT5G11630 82 / 2e-22 unknown protein Lus10028954 [exp] 53 / 2e-10 AT4G17310 100 / 5e-29 unknown protein Lus10007477 [exp] 53 / 2e-10 AT4G17310 95 / 6e-27 unknown protein Lus10026596 [exp] 36 / 0.0008 AT2G15000 123 / 6e-38 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G237800 [exp] 84 / 1e-22 AT5G11630 99 / 8e-29 unknown protein Potri.017G068600 [exp] 54 / 8e-11 AT4G17310 94 / 2e-26 unknown protein Potri.001G333800 [exp] 46 / 8e-08 AT5G47455 54 / 1e-10 unknown protein Potri.002G045600 [exp] 40 / 1e-05 AT5G11630 69 / 5e-17 unknown protein Potri.006G237900 [exp] 39 / 0.0001 AT4G32900 238 / 1e-80 Peptidyl-tRNA hydrolase II (PTH2) family protein (.1), Peptidyl-tRNA hydrolase II (PTH2) family protein (.2) Potri.004G154800 [exp] 37 / 0.0002 AT4G39300 97 / 1e-27 unknown protein Potri.009G115900 [exp] 36 / 0.0004 AT4G39300 114 / 1e-34 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0305 [flax] [poplar] PTH2 PF01981 [flax] [poplar] PTH2 Peptidyl-tRNA hydrolase PTH2
Representative CDS sequence Show only first row Show all	>Lus10002035 pacid=23142504 polypeptide=Lus10002035 locus=Lus10002035.g ID=Lus10002035.BGIv1.0 annot-version=v1.0 ATGTGGACTCCAGTAATGGTGACATTGAGCTTAAATCGGTGTTGGTGTGTCAGGCAAGACTTGAAGATGGGTACCGGAAAGATTGCCTCTCAATGTGCTC GTAAGATGCTTCATCTGCCGGTTGCTCAACTGGGAGCTCTCCAATCGCTTTTCCCGCTTCACTCTGCGGTCTCCTCAGCTCGCCTCACATCCTGCCTCGG CGCTGATACCAGCAGCTCCAGGTCGTTGTCTCAGGGTATGCTCTGCAGTGCCAACCCAGGAGTTTGA
AA sequence Show only first row Show all	>Lus10002035 pacid=23142504 polypeptide=Lus10002035 locus=Lus10002035.g ID=Lus10002035.BGIv1.0 annot-version=v1.0 MWTPVMVTLSLNRCWCVRQDLKMGTGKIASQCARKMLHLPVAQLGALQSLFPLHSAVSSARLTSCLGADTSSSRSLSQGMLCSANPGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G11630			unknown protein		Lus10002035 [exp]	0	1
AT1G58330		ZW2	transcription factor-related (...		Lus10028231 [exp]	6.1	0.6825
AT2G17080			Arabidopsis protein of unknown...		Lus10023962 [exp]	7.6	0.7392
AT3G14760			unknown protein		Lus10042496 [exp]	22.8	0.7066
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10016490 [exp]	24.7	0.7113
AT5G25590			Protein of unknown function (D...		Lus10007676 [exp]	29.0	0.7288
AT1G15170			MATE efflux family protein (.1...		Lus10018135 [exp]	29.9	0.7204
AT2G27610			Tetratricopeptide repeat (TPR)...		Lus10020588 [exp]	36.4	0.6115
AT5G62280			Protein of unknown function (D...		Lus10031701 [exp]	37.6	0.7267
AT3G52440	DOF	AtDof3,5	Dof-type zinc finger DNA-bindi...		Lus10029767 [exp]	41.9	0.7065
AT4G10750			Phosphoenolpyruvate carboxylas...		Lus10000223 [exp]	42.0	0.6715

Compare expression of checked genes

Lus10002035 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.