Lus10002042 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13560 81 / 6e-19 AAPT1, ATAAPT1 aminoalcoholphosphotransferase 1 (.1.2)
AT3G25585 75 / 9e-17 AAPT2, ATAAPT2 aminoalcoholphosphotransferase (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034410 86 / 9e-21 AT3G25585 509 / 0.0 aminoalcoholphosphotransferase (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G133800 91 / 3e-22 AT1G13560 695 / 0.0 aminoalcoholphosphotransferase 1 (.1.2)
Potri.008G109833 79 / 4e-18 AT1G13560 684 / 0.0 aminoalcoholphosphotransferase 1 (.1.2)
Potri.T031036 79 / 4e-18 AT1G13560 682 / 0.0 aminoalcoholphosphotransferase 1 (.1.2)
PFAM info
Representative CDS sequence
>Lus10002042 pacid=23145668 polypeptide=Lus10002042 locus=Lus10002042.g ID=Lus10002042.BGIv1.0 annot-version=v1.0
ATGTTCATGACAAGTCCGTTTGTTTGCTCTTGCTTCCCGAGTTCACTTGAAGGAGACAGTCTTTATGGGACTTCACCAAGACACTTGCTTTCTGGATTTT
TAGTTATTTTCTACCATTCTGGCTTGTTAATCACCATTTACCGCTATTCCAATCTGAGGGATGGGGTACATCGATCCCATGGACTTGCAGCACTTCATAG
ATACAAATACAGCGTAGTTGGTCACTCATATGTTGCCAAATATGTCTTGCAGCCCTTCTGGTCTAGATGCGTTTACTTCTTCCCTCTATGGATGCCACCA
AACATGATAAGCAATCCATTCTATTTAGCAACATGGGAAAGCTTTATCCCTTCATCGTGCGGATGGGAGATCCTAGTTTGGTAA
AA sequence
>Lus10002042 pacid=23145668 polypeptide=Lus10002042 locus=Lus10002042.g ID=Lus10002042.BGIv1.0 annot-version=v1.0
MFMTSPFVCSCFPSSLEGDSLYGTSPRHLLSGFLVIFYHSGLLITIYRYSNLRDGVHRSHGLAALHRYKYSVVGHSYVAKYVLQPFWSRCVYFFPLWMPP
NMISNPFYLATWESFIPSSCGWEILVW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G13560 AAPT1, ATAAPT1 aminoalcoholphosphotransferase... Lus10002042 0 1
AT5G47670 CCAAT NF-YB6, L1L "nuclear factor Y, subunit B6"... Lus10028845 1.4 0.7777
AT4G02210 unknown protein Lus10032996 6.9 0.6942
AT1G42480 unknown protein Lus10013214 7.3 0.5455
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10022912 8.0 0.6825
AT3G46290 HERK1 hercules receptor kinase 1 (.1... Lus10023325 9.3 0.6837
AT3G07200 RING/U-box superfamily protein... Lus10018271 12.0 0.6112
AT1G08080 ATACA7, ACA7 A. THALIANA ALPHA CARBONIC ANH... Lus10021456 17.8 0.6164
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10023564 18.2 0.6604
AT4G18360 Aldolase-type TIM barrel famil... Lus10042495 18.7 0.6146
AT4G22200 AKT3, AKT2/3 potassium transport 2/3 (.1) Lus10003644 22.6 0.6077

Lus10002042 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.