Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67090 73 / 4e-16 Subtilisin-like serine endopeptidase family protein (.1) AT3G14067 66 / 9e-14 Subtilase family protein (.1) AT5G67360 65 / 2e-13 ARA12 Subtilase family protein (.1) AT4G34980 61 / 9e-12 SLP2 subtilisin-like serine protease 2 (.1) AT5G51750 56 / 4e-10 ATSBT1.3 subtilase 1.3 (.1) AT1G01900 54 / 1e-09 SBTI1.1, ATSBT1.1 subtilase family protein (.1) AT1G04110 54 / 2e-09 SDD1 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) AT2G05920 52 / 1e-08 Subtilase family protein (.1) AT1G30600 48 / 2e-07 Subtilase family protein (.1) AT2G19170 48 / 3e-07 SLP3 subtilisin-like serine protease 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002392 [exp] 209 / 1e-64 AT5G67360 530 / 3e-178 Subtilase family protein (.1) Lus10027891 [exp] 208 / 3e-64 AT5G67360 531 / 3e-178 Subtilase family protein (.1) Lus10002393 [exp] 112 / 8e-30 AT5G67360 450 / 9e-148 Subtilase family protein (.1) Lus10027896 [exp] 99 / 2e-27 AT5G67360 58 / 4e-11 Subtilase family protein (.1) Lus10002398 [exp] 93 / 1e-24 AT5G67360 66 / 3e-20 Subtilase family protein (.1) Lus10018721 [exp] 93 / 6e-23 AT5G67360 531 / 7e-179 Subtilase family protein (.1) Lus10024815 [exp] 83 / 1e-19 AT5G67090 543 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10036546 [exp] 82 / 3e-19 AT1G01900 822 / 0.0 subtilase family protein (.1) Lus10013154 [exp] 78 / 9e-18 AT3G14067 915 / 0.0 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G100500 [exp] 148 / 1e-42 AT4G34980 541 / 0.0 subtilisin-like serine protease 2 (.1) Potri.014G026600 [exp] 91 / 3e-22 AT5G67360 546 / 0.0 Subtilase family protein (.1) Potri.014G026700 [exp] 85 / 2e-20 AT5G67090 582 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.007G045100 [exp] 83 / 1e-19 AT5G67090 727 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.003G067000 [exp] 82 / 2e-19 AT3G14067 969 / 0.0 Subtilase family protein (.1) Potri.003G118800 [exp] 80 / 1e-18 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.001G167300 [exp] 80 / 2e-18 AT3G14067 978 / 0.0 Subtilase family protein (.1) Potri.014G026500 [exp] 80 / 2e-18 AT5G67090 604 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.002G124500 [exp] 78 / 7e-18 AT5G67090 577 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.014G074600 [exp] 75 / 9e-17 AT1G01900 788 / 0.0 subtilase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0570 [flax] [poplar] PPP-I PF05922 [flax] [poplar] Inhibitor_I9 Peptidase inhibitor I9
Representative CDS sequence Show only first row Show all	>Lus10002044 pacid=23162006 polypeptide=Lus10002044 locus=Lus10002044.g ID=Lus10002044.BGIv1.0 annot-version=v1.0 ATGTCATCCGTCCGCAAGACCTACATCGTCCACATGGATAAATCAACAACTCTGAGTGTCTTCTCCACACCACATGATTGGTACATGTCGATACTCTCAT CCATGTCATTAGCTGACACGGACGACGACCAACCTATCCATCTCTACACCTACAAGCACGTCATCAACGGATTCAGTGATGTCCTCTCACAAGCCGAGCT CGACAAGCTTGAGCAGATCGACGGCCATGTGGCCTCGTTCCTTGAATCCTACGGCAGTCGACAGACAACCCACTCACCAAGATTTATGGGACTAAACAAA CACACAGGGTTGTGGCCAGCTGACAAGTTTGGTAATGCCATAATCATAGGTCAGTGGTGA
AA sequence Show only first row Show all	>Lus10002044 pacid=23162006 polypeptide=Lus10002044 locus=Lus10002044.g ID=Lus10002044.BGIv1.0 annot-version=v1.0 MSSVRKTYIVHMDKSTTLSVFSTPHDWYMSILSSMSLADTDDDQPIHLYTYKHVINGFSDVLSQAELDKLEQIDGHVASFLESYGSRQTTHSPRFMGLNK HTGLWPADKFGNAIIIGQW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G67090			Subtilisin-like serine endopep...		Lus10002044 [exp]	0	1
AT4G16195			Plant self-incompatibility pro...		Lus10017929 [exp]	1.0	1.0000
AT3G08720		ATPK2, ATPK19, ...	ARABIDOPSIS THALIANA SERINE/TH...		Lus10022732 [exp]	2.4	0.8803
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10016168 [exp]	2.4	1.0000
					Lus10034545 [exp]	3.0	1.0000
AT1G29430			SAUR-like auxin-responsive pro...		Lus10007059 [exp]	4.0	1.0000
AT1G08790			Protein of unknown function (D...		Lus10042536 [exp]	5.0	0.9118
AT5G08020		ATRPA70B	ARABIDOPSIS THALIANA RPA70-KDA...		Lus10042979 [exp]	6.3	0.8222
					Lus10028981 [exp]	6.9	0.8001
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029379 [exp]	7.0	0.8377
AT1G17615			Disease resistance protein (TI...		Lus10018023 [exp]	7.1	0.8054

Compare expression of checked genes

Lus10002044 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.