Lus10002050 [FLAX]

| External link |
|
||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Symbol | |||||||||||||||||||||
|
Arabidopsis homologues
|
No hit found | ||||||||||||||||||||
|
Paralogs
|
|
||||||||||||||||||||
|
Poplar homologues |
No hit found |
||||||||||||||||||||
| PFAM info | |||||||||||||||||||||
|
Representative CDS sequence |
>Lus10002050 pacid=23162000 polypeptide=Lus10002050 locus=Lus10002050.g ID=Lus10002050.BGIv1.0 annot-version=v1.0
ATGACGATGCAGTGCGCCGTCACACGGATCAGCAGGTACAGTTTCAGGCAGAGACTCGAGCTGCAATGGCTGATCTCACCTCCCGAGTCTACTGGTTGCA
GCGCCGAGATTATGAGAGGCATGGTGGATCTCCCCCACCCGGGCTACCATCATTCGAGTGACTCTAGTGTGGCTTTTCAGGACATTTAG
|
||||||||||||||||||||
|
AA sequence
|
>Lus10002050 pacid=23162000 polypeptide=Lus10002050 locus=Lus10002050.g ID=Lus10002050.BGIv1.0 annot-version=v1.0
MTMQCAVTRISRYSFRQRLELQWLISPPESTGCSAEIMRGMVDLPHPGYHHSSDSSVAFQDI
|
DESeq2's median of ratios [FLAX]
Coexpressed genes
Lus10002050 coexpression network
*The number of genes in the network is adjusted within 50 genes.*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.