Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62310 198 / 2e-59 transcription factor jumonji (jmjC) domain-containing protein (.1) AT3G07610 192 / 6e-57 IBM1 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) AT1G11950 189 / 2e-56 Transcription factor jumonji (jmjC) domain-containing protein (.1) AT4G00990 174 / 8e-51 Transcription factor jumonji (jmjC) domain-containing protein (.1) AT1G09060 122 / 9e-33 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1.2.3) AT4G21430 112 / 3e-29 B160 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027890 [exp] 283 / 5e-90 AT3G07610 578 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10002391 [exp] 270 / 5e-85 AT3G07610 607 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10015260 [exp] 210 / 2e-63 AT3G07610 627 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10020033 [exp] 195 / 3e-58 AT1G62310 843 / 0.0 transcription factor jumonji (jmjC) domain-containing protein (.1) Lus10020084 [exp] 132 / 5e-36 AT4G21430 529 / 2e-172 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1) Lus10006741 [exp] 130 / 2e-35 AT4G21430 440 / 1e-141 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1) Lus10025380 [exp] 130 / 3e-35 AT3G07610 516 / 8e-170 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10017092 [exp] 117 / 6e-31 AT1G09060 962 / 0.0 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1.2.3) Lus10004603 [exp] 110 / 9e-31 AT1G62310 107 / 3e-27 transcription factor jumonji (jmjC) domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G091200 [exp] 221 / 2e-67 AT3G07610 732 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Potri.005G082901 [exp] 221 / 3e-67 AT3G07610 702 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Potri.004G006200 [exp] 207 / 3e-62 AT1G11950 870 / 0.0 Transcription factor jumonji (jmjC) domain-containing protein (.1) Potri.011G009700 [exp] 203 / 5e-61 AT1G11950 863 / 0.0 Transcription factor jumonji (jmjC) domain-containing protein (.1) Potri.015G012800 [exp] 201 / 4e-60 AT4G00990 508 / 4e-157 Transcription factor jumonji (jmjC) domain-containing protein (.1) Potri.004G032700 [exp] 144 / 4e-40 AT4G21430 522 / 1e-169 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1) Potri.011G041400 [exp] 138 / 3e-38 AT4G21430 465 / 2e-148 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1) Potri.013G019000 [exp] 114 / 1e-29 AT1G09060 996 / 0.0 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1.2.3) Potri.005G027000 [exp] 107 / 2e-27 AT1G09060 759 / 0.0 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF02373 [flax] [poplar] JmjC JmjC domain, hydroxylase
Representative CDS sequence Show only first row Show all	>Lus10002052 pacid=23162007 polypeptide=Lus10002052 locus=Lus10002052.g ID=Lus10002052.BGIv1.0 annot-version=v1.0 ATGAAGGAAAATGGAGATGAAGTTTCAGAGGTGCAGAGAATTGACACAGTGGAGGGAGGTGCTCTATGGGAAATCTTCCGCAGAGAAGATGTTACGAAGC TGGAGGAATATCTTCCCAAGCACTTCAAAGAGTTCAGGCACATTCATTGTGTTCCTGTGCAAGAAGTCATTCATCCCATACATGATAAAAGCTTTTATTT GTATGAAGAACACAAAAGGAAGCTCAAAGAAGAATATGGTATTGAACCTTGGACGTTTGTCCAGAAACTTGGTGATGCTGTCTTTATACCTGCTGGATGT CCCCGTCAATCATGCATCAAGGTGGCATCAGACTTTGTCTCGCCCGAAAACGTTGGAGAGTGCATTCGTCTGACGGAGGAGTTCTGCCTTCTCCCAATAA ACCATCGTTCAAAGGAAGACAAATTGCAGGTACTGTTCATGACTGTAGTATGCATAATATTTCCGTTTGTCTATTCGAAGTGCTTGGATTTCACTCCTGT TTTTTTCTGA
AA sequence Show only first row Show all	>Lus10002052 pacid=23162007 polypeptide=Lus10002052 locus=Lus10002052.g ID=Lus10002052.BGIv1.0 annot-version=v1.0 MKENGDEVSEVQRIDTVEGGALWEIFRREDVTKLEEYLPKHFKEFRHIHCVPVQEVIHPIHDKSFYLYEEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGC PRQSCIKVASDFVSPENVGECIRLTEEFCLLPINHRSKEDKLQVLFMTVVCIIFPFVYSKCLDFTPVFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62310			transcription factor jumonji (...		Lus10002052 [exp]	0	1
AT1G65420		NPQ7	NONPHOTOCHEMICAL QUENCHING 7, ...		Lus10027674 [exp]	5.0	0.8009
AT5G58240		FHIT	FRAGILE HISTIDINE TRIAD (.1.2)		Lus10019126 [exp]	20.0	0.7751
AT3G50360		CEN1, ATCEN2	CENTRIN 1, centrin2 (.1)		Lus10009353 [exp]	21.3	0.7693
AT3G59800			unknown protein		Lus10008338 [exp]	30.9	0.7565
AT1G10890			unknown protein		Lus10043141 [exp]	36.9	0.7642
					Lus10019733 [exp]	42.5	0.6953
AT3G05700			Drought-responsive family prot...		Lus10001462 [exp]	46.8	0.7056
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10030353 [exp]	49.6	0.7168
AT5G02930			F-box/RNI-like superfamily pro...		Lus10029589 [exp]	52.0	0.7326
AT5G64680			unknown protein		Lus10011265 [exp]	58.5	0.7359

Compare expression of checked genes

Lus10002052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.