Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74670 132 / 1e-41 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 121 / 2e-37 GASA4 GAST1 protein homolog 4 (.1.2) AT3G10185 86 / 3e-23 Gibberellin-regulated family protein (.1) AT2G30810 82 / 9e-22 Gibberellin-regulated family protein (.1) AT3G02885 82 / 1e-21 GASA5 GAST1 protein homolog 5 (.1) AT2G39540 69 / 8e-17 Gibberellin-regulated family protein (.1) AT1G10588 67 / 5e-16 Gibberellin-regulated family protein (.1.2) AT5G59845 66 / 3e-15 Gibberellin-regulated family protein (.1) AT1G22690 64 / 2e-14 Gibberellin-regulated family protein (.1.2.3) AT4G09600 61 / 2e-13 GASA3 GAST1 protein homolog 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042203 [exp] 170 / 1e-56 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10008612 [exp] 156 / 3e-51 AT1G74670 138 / 8e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10030680 [exp] 125 / 7e-39 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10024216 [exp] 119 / 4e-36 AT1G74670 106 / 1e-30 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10029340 [exp] 106 / 2e-31 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10018016 [exp] 103 / 7e-30 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10005241 [exp] 101 / 3e-29 ND 96 / 4e-27 Lus10004048 [exp] 96 / 4e-27 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042012 [exp] 91 / 4e-25 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G083000 [exp] 121 / 4e-37 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2) Potri.001G254100 [exp] 110 / 7e-33 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.006G044400 [exp] 102 / 8e-30 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 96 / 4e-27 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.001G315500 [exp] 89 / 2e-24 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.014G020100 [exp] 67 / 4e-16 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.013G113400 [exp] 67 / 1e-15 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.019G083900 [exp] 66 / 3e-15 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) Potri.005G239000 [exp] 62 / 4e-14 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 61 / 1e-13 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10002059 pacid=23162013 polypeptide=Lus10002059 locus=Lus10002059.g ID=Lus10002059.BGIv1.0 annot-version=v1.0 ATGGCAATGTCGGGTAATAAGATGGCGTGTCTCTTGATTCTCGCCATTCTTGGCATGTCCATGGTCACTACTCATGTTATGGCACGGGGGAATCATGGGC CTGGAAGTCTCAAGAGCTACCAATGCGGGTCGCAGTGTACTCGGAGATGCAGTAGAACGCAGTACAGGAAGCCATGCCTCTTCTTCTGCAACAAGTGCTG CGCAAAGTGCCTATGCGTGCCTCCTGGCTTCTACGGGAACAAGGGAGTGTGCCCTTGCTACAACAACTGGAAGACCCAGCAAGGAGGCCCCAAGTGCCCT TAA
AA sequence Show only first row Show all	>Lus10002059 pacid=23162013 polypeptide=Lus10002059 locus=Lus10002059.g ID=Lus10002059.BGIv1.0 annot-version=v1.0 MAMSGNKMACLLILAILGMSMVTTHVMARGNHGPGSLKSYQCGSQCTRRCSRTQYRKPCLFFCNKCCAKCLCVPPGFYGNKGVCPCYNNWKTQQGGPKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10002059 [exp]	0	1
AT3G23110		EMB2800, AtRLP3...	EMBRYO DEFECTIVE 2800, recepto...		Lus10006824 [exp]	2.0	0.8795
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10006825 [exp]	3.5	0.8787
AT1G74250			DNAJ heat shock N-terminal dom...		Lus10012524 [exp]	4.2	0.8463
					Lus10000834 [exp]	7.4	0.8230
AT2G17480		ATMLO8, MLO8	MILDEW RESISTANCE LOCUS O 8, S...		Lus10019630 [exp]	13.2	0.7648
AT5G23940		PEL3, DCR, EMB3...	PERMEABLE LEAVES3, EMBRYO DEFE...		Lus10027500 [exp]	17.7	0.8253
AT2G04740			ankyrin repeat family protein ...		Lus10006408 [exp]	17.7	0.8106
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10032062 [exp]	19.3	0.7573
AT1G45160			Protein kinase superfamily pro...		Lus10005470 [exp]	19.6	0.8385
AT4G21870			HSP20-like chaperones superfam...		Lus10007666 [exp]	21.1	0.7868

Compare expression of checked genes

Lus10002059 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.