Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024213 [exp] 162 / 6e-54 ND 40 / 3e-05 Lus10037173 [exp] 58 / 2e-12 ND 40 / 4e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G086100 [exp] 76 / 2e-19 AT1G69588 52 / 7e-10 CLAVATA3/ESR-RELATED 45 (.1) Potri.010G169300 [exp] 76 / 2e-19 AT1G69588 57 / 1e-11 CLAVATA3/ESR-RELATED 45 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002061 pacid=23162010 polypeptide=Lus10002061 locus=Lus10002061.g ID=Lus10002061.BGIv1.0 annot-version=v1.0 ATGGGTTTAAGAGTGATTCTCCTACTCTTCTGCATTGGGAATTTAGCTTTTCAACCCGAGAAGGTTTCTGCATTGACAAGCATTGATCTTGTTTTGAGAT GGTGGCATCCTCAACATTCATCGCGTATCCTGAAAGATGTGTCTGTGGATTATTTGCAGACGAGATTTATAAACATGGCACCGGCGCCTTCAATGATGTT CGATCCTAACCAATCCAACAAAAGAACGGTTAAGAAAGGATCGGATCCCATCCACAACAGACAGTAG
AA sequence Show only first row Show all	>Lus10002061 pacid=23162010 polypeptide=Lus10002061 locus=Lus10002061.g ID=Lus10002061.BGIv1.0 annot-version=v1.0 MGLRVILLLFCIGNLAFQPEKVSALTSIDLVLRWWHPQHSSRILKDVSVDYLQTRFINMAPAPSMMFDPNQSNKRTVKKGSDPIHNRQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002061 [exp]	0	1
					Lus10024213 [exp]	1.0	0.8974
AT5G28650	WRKY	ATWRKY74, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10042538 [exp]	4.7	0.8736
AT2G35150		EXL7, EXL1	EXORDIUM LIKE 7, EXORDIUM like...		Lus10017139 [exp]	5.7	0.8507
AT5G28650	WRKY	ATWRKY74, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10021999 [exp]	5.9	0.8367
AT5G26990			Drought-responsive family prot...		Lus10017956 [exp]	6.0	0.8202
AT4G24630			DHHC-type zinc finger family p...		Lus10033527 [exp]	7.7	0.8092
AT1G62050			Ankyrin repeat family protein ...		Lus10002942 [exp]	8.3	0.8558
AT2G32010		CVL1	CVP2 like 1 (.1.2)		Lus10006597 [exp]	10.2	0.8093
AT1G49390			2-oxoglutarate (2OG) and Fe(II...		Lus10039975 [exp]	12.8	0.7512
AT4G13600			Carbohydrate-binding X8 domain...		Lus10032601 [exp]	13.8	0.8454

Compare expression of checked genes

Lus10002061 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.