Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20710 74 / 3e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G02150 73 / 7e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G60770 68 / 5e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G21705 60 / 3e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G02820 59 / 6e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G02370 56 / 8e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G15480 54 / 5e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G35130 49 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G15590 47 / 7e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09900 41 / 0.0001 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016229 [exp] 197 / 8e-63 AT2G20710 269 / 7e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10033698 [exp] 86 / 2e-20 AT2G20710 349 / 4e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10013047 [exp] 73 / 1e-15 AT1G60770 682 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10024781 [exp] 72 / 1e-15 AT1G02150 599 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009787 [exp] 72 / 3e-15 AT1G02150 600 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018588 [exp] 70 / 1e-14 AT2G20710 303 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10001213 [exp] 67 / 8e-14 AT4G21705 500 / 2e-174 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031004 [exp] 56 / 6e-10 AT1G80270 532 / 0.0 PENTATRICOPEPTIDE REPEAT 596 (.1.2.3) Lus10027552 [exp] 56 / 9e-10 AT3G06430 501 / 1e-175 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G063400 [exp] 107 / 5e-28 AT2G20710 349 / 3e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.016G063300 [exp] 93 / 6e-23 AT2G20710 345 / 1e-113 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G132700 [exp] 90 / 9e-22 AT2G20710 387 / 2e-130 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.014G050300 [exp] 78 / 2e-17 AT1G02150 698 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G132500 [exp] 77 / 4e-17 AT2G20710 388 / 4e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.011G051500 [exp] 76 / 5e-17 AT4G21705 605 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G042500 [exp] 74 / 2e-16 AT4G21705 608 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G133000 [exp] 73 / 9e-16 AT2G20710 310 / 1e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.018G079600 [exp] 71 / 5e-15 AT1G60770 701 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G139400 [exp] 71 / 6e-15 AT1G02150 714 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10002062 pacid=23162005 polypeptide=Lus10002062 locus=Lus10002062.g ID=Lus10002062.BGIv1.0 annot-version=v1.0 ATGAGGGACTTAGGGATCAACAAGAAGAGCCTCCATTGCAATACTTTTCTCACTCTTTACCATCGAATCAGGGACACAAAGAAGTTCGACAATCTTATCA AGGAAATGGACGACTGCGGCATTCCATATGATGTCGCAACATATAACATACTGGTTACTGCATTTGGATCCGCTTCTGATGTTAAAGGGATGGAAAGAAC TCTGATAAAGATGGAATCCGACCCGGATGTCACCTCGGACTGGGCCATATACAACACTGCCGCAACAAATTACAGAAAGACCGAACTTTTCGACAAGGGT GTGAAAATGCTGAAGAAAGTCGAGGGACTTATCAGCGGAAGGACTTATCAGAAAGAAGAAAGATATCAAAGCATACTATTACCTCCTCACACGCAGCGCA GCCATGGGGAAGAAAGATGA
AA sequence Show only first row Show all	>Lus10002062 pacid=23162005 polypeptide=Lus10002062 locus=Lus10002062.g ID=Lus10002062.BGIv1.0 annot-version=v1.0 MRDLGINKKSLHCNTFLTLYHRIRDTKKFDNLIKEMDDCGIPYDVATYNILVTAFGSASDVKGMERTLIKMESDPDVTSDWAIYNTAATNYRKTELFDKG VKMLKKVEGLISGRTYQKEERYQSILLPPHTQRSHGEER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10002062 [exp]	0	1
AT4G35310		CPK5, ATCPK5	calmodulin-domain protein kina...		Lus10016191 [exp]	1.0	0.9321
					Lus10039269 [exp]	1.7	0.7705
AT4G10260			pfkB-like carbohydrate kinase ...		Lus10040562 [exp]	2.0	0.7924
AT4G20060		EMB1895	EMBRYO DEFECTIVE 1895, ARM rep...		Lus10038371 [exp]	15.2	0.7256
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Lus10006277 [exp]	17.0	0.7256
AT2G29670			Tetratricopeptide repeat (TPR)...		Lus10025981 [exp]	18.7	0.7256
AT5G51740			Peptidase family M48 family pr...		Lus10032437 [exp]	20.1	0.7256
AT4G33920			Protein phosphatase 2C family ...		Lus10000700 [exp]	21.5	0.7256
AT1G01450			Protein kinase superfamily pro...		Lus10041113 [exp]	22.8	0.7256
AT3G06920			Tetratricopeptide repeat (TPR)...		Lus10038657 [exp]	24.1	0.7256

Compare expression of checked genes

Lus10002062 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.