Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61780 82 / 1e-21 postsynaptic protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007644 [exp] 94 / 1e-26 AT1G61780 172 / 1e-57 postsynaptic protein-related (.1) Lus10018365 [exp] 97 / 6e-25 AT1G11545 510 / 0.0 xyloglucan endotransglucosylase/hydrolase 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G021200 [exp] 87 / 5e-24 AT1G61780 176 / 3e-59 postsynaptic protein-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10235 [flax] [poplar] Cript Microtubule-associated protein CRIPT
Representative CDS sequence Show only first row Show all	>Lus10002066 pacid=23153387 polypeptide=Lus10002066 locus=Lus10002066.g ID=Lus10002066.BGIv1.0 annot-version=v1.0 ATGTTCTTATTTGGTACTTTACATGTGAACTTGGTTACCAGATGGACACCTTATGGAGTAATCAAGTGCATGATCTGCAAGCAGCAAGTGCACCAAGATG GCAAGTACTGCCACACCTGTGCTTATACCAAAGGTAATCCAGTCATTTCTACTAACTTCTCCGATCTTCTTCATGGTCTCTGCTTCAATCTACTTTATCT GACGGTTGACATTGCTCGAAATTTGGGTACAAGAGTCTGTGTGATGTGCGGCAAGCAAGTTCTCGACACGAAGATATACAAGCAAAGCAACGTATAA
AA sequence Show only first row Show all	>Lus10002066 pacid=23153387 polypeptide=Lus10002066 locus=Lus10002066.g ID=Lus10002066.BGIv1.0 annot-version=v1.0 MFLFGTLHVNLVTRWTPYGVIKCMICKQQVHQDGKYCHTCAYTKGNPVISTNFSDLLHGLCFNLLYLTVDIARNLGTRVCVMCGKQVLDTKIYKQSNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61780			postsynaptic protein-related (...		Lus10002066 [exp]	0	1
AT3G27670		RST1	RESURRECTION1, ARM repeat supe...		Lus10010374 [exp]	2.4	0.9045
AT1G19100			Histidine kinase-, DNA gyrase ...		Lus10039959 [exp]	3.7	0.9072
AT1G55200			Protein kinase protein with ad...		Lus10036100 [exp]	6.3	0.9001
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Lus10011126 [exp]	6.9	0.9005
AT4G39952			Pentatricopeptide repeat (PPR)...		Lus10010688 [exp]	8.1	0.9032
AT1G55340			Protein of unknown function (D...		Lus10010312 [exp]	11.2	0.8659
AT5G06830			unknown protein		Lus10016277 [exp]	12.4	0.8897
AT5G49570		ATPNG1	peptide-N-glycanase 1 (.1)		Lus10015918 [exp]	13.8	0.8655
AT1G04610		YUC3	YUCCA 3 (.1)		Lus10032609 [exp]	13.8	0.8850
AT4G33060			Cyclophilin-like peptidyl-prol...		Lus10026441 [exp]	17.0	0.8784

Compare expression of checked genes

Lus10002066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.