Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18750 96 / 6e-24 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G46790 95 / 1e-23 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G15510 94 / 3e-23 VAC1, ATECB2 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G69350 94 / 4e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G25270 94 / 4e-23 OTP70 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22410 94 / 5e-23 SLO1 SLOW GROWTH 1 (.1) AT1G59720 94 / 5e-23 CRR28 CHLORORESPIRATORY REDUCTION28, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G08070 94 / 6e-23 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G56570 93 / 7e-23 PGN PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G39952 92 / 2e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027366 [exp] 236 / 5e-75 AT2G40720 328 / 7e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014707 [exp] 115 / 9e-31 AT3G63370 893 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004081 [exp] 110 / 5e-29 AT3G63370 893 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004987 [exp] 99 / 5e-25 AT3G46790 715 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018492 [exp] 99 / 5e-25 AT4G18750 385 / 2e-123 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002552 [exp] 95 / 2e-24 AT2G22410 299 / 2e-97 SLOW GROWTH 1 (.1) Lus10014211 [exp] 97 / 5e-24 AT3G11460 791 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039703 [exp] 96 / 1e-23 AT4G18750 394 / 6e-127 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10037362 [exp] 95 / 2e-23 AT3G57430 477 / 9e-158 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G258500 [exp] 164 / 6e-48 AT2G40720 481 / 4e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G215500 [exp] 102 / 5e-26 AT3G63370 922 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G040100 [exp] 100 / 1e-25 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G199800 [exp] 99 / 4e-25 AT1G34160 702 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G245200 [exp] 98 / 1e-24 AT3G25060 683 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G064301 [exp] 92 / 1e-24 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.012G111900 [exp] 98 / 2e-24 AT4G33990 518 / 1e-173 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G041200 [exp] 97 / 3e-24 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G019500 [exp] 97 / 3e-24 AT2G22410 791 / 0.0 SLOW GROWTH 1 (.1) Potri.018G144401 [exp] 90 / 6e-24 AT2G34400 164 / 9e-49 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10002070 pacid=23153393 polypeptide=Lus10002070 locus=Lus10002070.g ID=Lus10002070.BGIv1.0 annot-version=v1.0 ATGTACATGACTTGTGGCGATGAAGCAACAGCTAGTGATCTCTTCGAGGCCTGTTCCACTCGAGACACTATCTCGTGGAATGCTATGATTTCCGCCTATG TGAAGAGGAACAAAGCCGATGAAGCCCTGTCGCTGTTTACTCGTATGATGTCCGAAGTGGACCCTAATCCCATCACAGTGATCAACATTCTGTCAATATG TACGGATCTGCCACGGGGACAGCAACTGCACGGTTTTGTAACTCGTCGATTCTCGTTCCATTTCAGTCTAGAACCATCTCTAGCTAATGCCCTAATCACA ATGTATGCAAGGTGTGGCAGTTTGAAGAAATTTGAAACCATCTTTAGTAATATTCTTCAGGATTCGAAGAATCTAGTCTCGTGGAACACCATGATCAATG CTTACTCGACACACTGA
AA sequence Show only first row Show all	>Lus10002070 pacid=23153393 polypeptide=Lus10002070 locus=Lus10002070.g ID=Lus10002070.BGIv1.0 annot-version=v1.0 MYMTCGDEATASDLFEACSTRDTISWNAMISAYVKRNKADEALSLFTRMMSEVDPNPITVINILSICTDLPRGQQLHGFVTRRFSFHFSLEPSLANALIT MYARCGSLKKFETIFSNILQDSKNLVSWNTMINAYSTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18750		DOT4	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10002070 [exp]	0	1
AT1G79400		ATCHX2	cation/H+ exchanger 2, cation/...		Lus10026156 [exp]	3.7	0.8692
AT2G27710			60S acidic ribosomal protein f...		Lus10014070 [exp]	10.4	0.7838
AT2G22560			Kinase interacting (KIP1-like)...		Lus10002655 [exp]	11.0	0.8451
AT2G44290			Bifunctional inhibitor/lipid-t...		Lus10033076 [exp]	11.5	0.8636
AT3G54070			Ankyrin repeat family protein ...		Lus10038357 [exp]	12.7	0.8534
AT1G60200			splicing factor PWI domain-con...		Lus10030866 [exp]	15.7	0.8218
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10028102 [exp]	19.6	0.8435
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10018138 [exp]	25.0	0.8487
AT5G37720		DIP2, ALY4	interacting with DNA-binding d...		Lus10000446 [exp]	25.3	0.8533
AT4G00330		CRCK2	calmodulin-binding receptor-li...		Lus10017787 [exp]	25.7	0.7967

Compare expression of checked genes

Lus10002070 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.