Lus10002077 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001147 82 / 2e-19 AT1G64570 540 / 4e-171 DUO POLLEN 3, Homeodomain-like superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10002077 pacid=23153391 polypeptide=Lus10002077 locus=Lus10002077.g ID=Lus10002077.BGIv1.0 annot-version=v1.0
ATGTTGCAGACACAAAGGAGCCTTGGGGGACTTTGTGTCACANNTGGGGACTGCGCTTGTACGGAAAATCTTTGTGCTGGGACAGAGAAGGTTGTAAGTG
ACAACAGTAGTGCGGCAGGGATAGGGAGTCCTGCGTTGAAGTTAAGTCTGACTATGCTGGGGAAGGATGGAGATAGTAACACTTGGTTAAGATTAGACTA
CCCTGTTGGTGGTGGGCGGATTCTGAATTCTGATATCATCATCTTAAGTCCTAAGGCTGATGCTCTCTTCCTAGACTAA
AA sequence
>Lus10002077 pacid=23153391 polypeptide=Lus10002077 locus=Lus10002077.g ID=Lus10002077.BGIv1.0 annot-version=v1.0
MLQTQRSLGGLCVTXGDCACTENLCAGTEKVVSDNSSAAGIGSPALKLSLTMLGKDGDSNTWLRLDYPVGGGRILNSDIIILSPKADALFLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002077 0 1
AT2G17280 Phosphoglycerate mutase family... Lus10032820 3.0 0.6543
AT3G11010 AtRLP34 receptor like protein 34 (.1) Lus10002752 3.5 0.5496
AT1G19835 Plant protein of unknown funct... Lus10033813 10.7 0.5216
AT1G58025 DNA-binding bromodomain-contai... Lus10035797 19.7 0.5871
AT2G29620 unknown protein Lus10001202 25.0 0.4596
AT1G07480 Transcription factor IIA, alph... Lus10004981 39.5 0.5146
AT2G34440 MADS AGL29 AGAMOUS-like 29 (.1) Lus10016563 43.1 0.4830
AT4G17920 RING/U-box superfamily protein... Lus10004572 66.8 0.4545
AT1G02030 C2H2ZnF C2H2-like zinc finger protein ... Lus10024763 101.2 0.3904
AT5G05480 Peptide-N4-(N-acetyl-beta-gluc... Lus10007519 103.0 0.3520

Lus10002077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.