Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027424 [exp] 66 / 3e-15 ND / Lus10005768 [exp] 67 / 4e-15 AT5G52140 90 / 7e-21 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002080 pacid=23153390 polypeptide=Lus10002080 locus=Lus10002080.g ID=Lus10002080.BGIv1.0 annot-version=v1.0 ATGTCAAATGGGACAACCCCCATTTTTCCTGTTGATGAAGCTTTGGCTAGACAGTTGCCGAAGCTGGGTGGGGTTCGGGATGGACAGGATGAAGAAGCTT TAGCCTTAAAATTCACCGAGATGGAATTGTTGAGCAAAGCTCGCGGAACTGCAACCATCGGTTGGTGGATTGGGATATCTGAGTCGTTAATTTGGAAACG GCCGCAGACGGCTCAGAAGAAGAACTAA
AA sequence Show only first row Show all	>Lus10002080 pacid=23153390 polypeptide=Lus10002080 locus=Lus10002080.g ID=Lus10002080.BGIv1.0 annot-version=v1.0 MSNGTTPIFPVDEALARQLPKLGGVRDGQDEEALALKFTEMELLSKARGTATIGWWIGISESLIWKRPQTAQKKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002080 [exp]	0	1
AT5G63060			Sec14p-like phosphatidylinosit...		Lus10039952 [exp]	5.2	0.7905
AT3G11591			unknown protein		Lus10016986 [exp]	7.6	0.7997
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10036009 [exp]	8.4	0.8021
AT1G09030	CCAAT	NF-YB4	"nuclear factor Y, subunit B4"...		Lus10029908 [exp]	11.7	0.7276
AT5G46030			unknown protein		Lus10025438 [exp]	13.6	0.7898
AT3G11980		FAR2, MS2	MALE STERILITY 2, FATTY ACID R...		Lus10029336 [exp]	14.7	0.7492
AT4G38840			SAUR-like auxin-responsive pro...		Lus10032173 [exp]	16.5	0.7566
AT5G40600		EMB1875	unknown protein		Lus10003647 [exp]	19.9	0.7794
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10026912 [exp]	25.0	0.7507
AT1G09030	CCAAT	NF-YB4	"nuclear factor Y, subunit B4"...		Lus10004493 [exp]	27.3	0.7079

Compare expression of checked genes

Lus10002080 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.