Lus10002084 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64040 178 / 6e-58 PSAN, PSI-N photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.1), photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003849 224 / 5e-76 AT5G64040 207 / 2e-69 photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.1), photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G063300 175 / 1e-56 AT5G64040 224 / 5e-76 photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.1), photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.2)
Potri.007G105900 173 / 6e-56 AT5G64040 231 / 1e-78 photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.1), photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05479 PsaN Photosystem I reaction centre subunit N (PSAN or PSI-N)
Representative CDS sequence
>Lus10002084 pacid=23151635 polypeptide=Lus10002084 locus=Lus10002084.g ID=Lus10002084.BGIv1.0 annot-version=v1.0
ATGGCAGCCACCAGCATGATGATGAGCTCCTCTTCCAGTGTCCTTGCCTGCAAGTACACAACCAAATCTTCATCGTCAACCACTAGGAAGTTCCCAGTGA
TCAGAGCTCAGCAAGGAGACCGTGAAGCTGGAAATGGGAAGAAGGCTGCAGTGGCTTTCCTTGCAGCTACTCTGTTTGCCACCGCAACTGTTTCTACTTC
CTTCTCTGCCAACGCTGGTGTCATCGATGACTACCTTGAGAAGAGCAAAATCAACAAGGAGTTGAATGACCAGAAGAGGCTAGCAACAAGTGGAGCCAAC
TTTGCAAGAGCTTACACTGTCCAGTTTGGCTCCTGCAAGTTCCCTGAGAACTTCACTGGATGCCAGGATCTTGCCAAGCAGAAGAAAGTGCCATTCATCT
CTGAGGATTTGGAGTTGGAGTGCAAAGGAAAAGACAAGTACAAGTGTGGCTCTAATGTTTTCTGGAAATGGTGA
AA sequence
>Lus10002084 pacid=23151635 polypeptide=Lus10002084 locus=Lus10002084.g ID=Lus10002084.BGIv1.0 annot-version=v1.0
MAATSMMMSSSSSVLACKYTTKSSSSTTRKFPVIRAQQGDREAGNGKKAAVAFLAATLFATATVSTSFSANAGVIDDYLEKSKINKELNDQKRLATSGAN
FARAYTVQFGSCKFPENFTGCQDLAKQKKVPFISEDLELECKGKDKYKCGSNVFWKW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Lus10002084 0 1
AT1G52230 PSAH2, PSAH-2, ... PHOTOSYSTEM I SUBUNIT H-2, pho... Lus10025798 1.7 0.9928
AT1G52230 PSAH2, PSAH-2, ... PHOTOSYSTEM I SUBUNIT H-2, pho... Lus10035864 2.4 0.9885
AT1G30380 PSAK photosystem I subunit K (.1) Lus10007399 2.4 0.9892
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Lus10003849 2.6 0.9793
AT2G42220 Rhodanese/Cell cycle control p... Lus10021032 3.5 0.9806
AT2G20260 PSAE-2 photosystem I subunit E-2 (.1) Lus10011913 4.0 0.9881
AT1G30380 PSAK photosystem I subunit K (.1) Lus10012086 4.5 0.9881
AT2G42220 Rhodanese/Cell cycle control p... Lus10023820 4.9 0.9774
AT1G08380 PSAO photosystem I subunit O (.1) Lus10013310 7.1 0.9625
AT1G18170 FKBP-like peptidyl-prolyl cis-... Lus10038954 7.3 0.9769

Lus10002084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.