Lus10002099 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17930 39 / 0.0007 Aminotransferase-like, plant mobile domain family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008144 160 / 4e-51 AT1G17930 54 / 4e-10 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10023395 124 / 1e-36 AT1G17930 52 / 4e-08 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10033258 120 / 8e-36 AT1G17930 56 / 3e-10 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10008465 72 / 1e-16 AT2G04865 49 / 2e-07 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10009805 63 / 2e-12 AT2G25010 54 / 6e-08 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10032799 59 / 8e-12 AT2G04865 64 / 6e-13 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10004447 56 / 6e-11 AT1G17930 47 / 3e-07 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10005722 49 / 2e-07 ND /
Lus10020617 44 / 6e-06 AT2G04865 40 / 3e-04 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10536 PMD Plant mobile domain
Representative CDS sequence
>Lus10002099 pacid=23161678 polypeptide=Lus10002099 locus=Lus10002099.g ID=Lus10002099.BGIv1.0 annot-version=v1.0
ATGCTTGCCACTATGCTTAATGTTGATGGGGATGAGATCAGGCGGAAGTGCTACAGAGCAGGCGGTTTTCATCTAGACCACCTAGTCGAGGCTACTGAGG
CTCGATACGTTGACGATGCTAGCACAGTGGTTTGCTACTTGATTATGTTGCTGGAATCTACTGCTTTTTGTGACCGCAGTCAGAACCGTGTCATTATTGG
GGTTCTCGAGGGGTTGCGAGACGTGCGGATGACTCGGGAGTACAGATGGAGTGCGGCTACACTTGCTTTCATGTACAGGGTTGCTTCTCAAGCTGCCTTA
CTTTGCTGCAGTCGTGAATCTATGAGTACTTCTCGAGCTTACATTGTAGGTCGACCCCGGCCCCACGTGGTAGTGGGGAGGCACTTGCTGGGAGGTGGGA
AGGACGGAGGGTCGTTGACAGAGCAGCTGATGCGGATGCGAGGCTAG
AA sequence
>Lus10002099 pacid=23161678 polypeptide=Lus10002099 locus=Lus10002099.g ID=Lus10002099.BGIv1.0 annot-version=v1.0
MLATMLNVDGDEIRRKCYRAGGFHLDHLVEATEARYVDDASTVVCYLIMLLESTAFCDRSQNRVIIGVLEGLRDVRMTREYRWSAATLAFMYRVASQAAL
LCCSRESMSTSRAYIVGRPRPHVVVGRHLLGGGKDGGSLTEQLMRMRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002099 0 1
Lus10000325 1.0 1.0000
AT2G46760 D-arabinono-1,4-lactone oxidas... Lus10004735 1.4 1.0000
Lus10025316 2.2 1.0000
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10030510 2.4 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10005495 2.4 1.0000
AT5G39200 unknown protein Lus10030710 2.6 1.0000
Lus10011594 2.8 1.0000
Lus10032121 3.2 1.0000
AT1G64660 ATMGL methionine gamma-lyase (.1) Lus10033233 3.3 1.0000
AT4G20800 FAD-binding Berberine family p... Lus10006507 3.5 1.0000

Lus10002099 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.