Lus10002102 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038520 119 / 1e-34 ND /
Lus10023285 107 / 1e-29 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G081701 58 / 4e-11 ND /
PFAM info
Representative CDS sequence
>Lus10002102 pacid=23161677 polypeptide=Lus10002102 locus=Lus10002102.g ID=Lus10002102.BGIv1.0 annot-version=v1.0
ATGCTATTCGGGAAGGAAATAGTGATGGAGCTGGCTTTCTACGATGCCTACGCCGGAGAATCCAAAGACGGCAGCTTGTCCGCCTCACCCGCAAGATTCT
CAATGGGAGACGCCGTCTCTATGTGCGTGGTGGTCTCCAAACCGGTGGGATCCACCAAATGTTGCACCTCCTACGACGACTTGTCATACGCGAATTTAGC
GTTGTGTAGATCCAGATTCTCGAGGTTGAAAGGCGTTGTTCATTTGCAATCGGAAGAACACAAGAGTTTCAAGGCTGATGCCCTGGACTGGAGTGGGATC
TGA
AA sequence
>Lus10002102 pacid=23161677 polypeptide=Lus10002102 locus=Lus10002102.g ID=Lus10002102.BGIv1.0 annot-version=v1.0
MLFGKEIVMELAFYDAYAGESKDGSLSASPARFSMGDAVSMCVVVSKPVGSTKCCTSYDDLSYANLALCRSRFSRLKGVVHLQSEEHKSFKADALDWSGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002102 0 1
AT2G23540 GDSL-like Lipase/Acylhydrolase... Lus10016918 24.8 0.6532
AT1G30800 Fasciclin-like arabinogalactan... Lus10023390 29.9 0.5827
AT3G49700 AtACS9, ACS9, E... ETHYLENE OVERPRODUCING 3, 1-am... Lus10007249 33.9 0.6164
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10026419 43.5 0.6381
Lus10003442 83.2 0.5641
AT5G06740 Concanavalin A-like lectin pro... Lus10029290 94.7 0.5421
AT4G30630 unknown protein Lus10026889 134.0 0.5559
AT1G19250 FMO1 flavin-dependent monooxygenase... Lus10008454 135.1 0.5485
Lus10019938 186.6 0.5526
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Lus10033119 211.1 0.5489

Lus10002102 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.