Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34290 87 / 6e-24 SWIB/MDM2 domain superfamily protein (.1) AT2G14880 85 / 4e-23 SWIB/MDM2 domain superfamily protein (.1) AT3G03590 73 / 3e-18 SWIB/MDM2 domain superfamily protein (.1) AT2G35605 67 / 3e-16 SWIB/MDM2 domain superfamily protein (.1) AT1G31760 63 / 2e-14 SWIB/MDM2 domain superfamily protein (.1) AT4G26810 49 / 4e-09 SWIB/MDM2 domain superfamily protein (.1.2) AT1G49520 44 / 2e-06 SWIB complex BAF60b domain-containing protein (.1) AT3G19080 42 / 4e-06 SWIB complex BAF60b domain-containing protein (.1) AT3G48600 41 / 1e-05 SWIB complex BAF60b domain-containing protein (.1.2) AT4G22360 41 / 1e-05 SWIB complex BAF60b domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013893 [exp] 114 / 2e-34 AT2G14880 143 / 7e-45 SWIB/MDM2 domain superfamily protein (.1) Lus10005667 [exp] 68 / 3e-16 AT3G03590 118 / 4e-35 SWIB/MDM2 domain superfamily protein (.1) Lus10038799 [exp] 49 / 1e-08 AT4G26810 160 / 1e-50 SWIB/MDM2 domain superfamily protein (.1.2) Lus10013894 [exp] 49 / 3e-08 AT5G02860 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10019640 [exp] 47 / 2e-07 AT3G19080 256 / 2e-81 SWIB complex BAF60b domain-containing protein (.1) Lus10033312 [exp] 42 / 1e-06 AT2G35605 68 / 6e-16 SWIB/MDM2 domain superfamily protein (.1) Lus10034774 [exp] 42 / 1e-06 AT2G35605 68 / 6e-16 SWIB/MDM2 domain superfamily protein (.1) Lus10009333 [exp] 44 / 2e-06 AT3G19080 266 / 4e-87 SWIB complex BAF60b domain-containing protein (.1) Lus10014892 [exp] 41 / 2e-05 AT4G22360 243 / 2e-76 SWIB complex BAF60b domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G092200 [exp] 97 / 8e-28 AT2G14880 169 / 7e-55 SWIB/MDM2 domain superfamily protein (.1) Potri.001G297400 [exp] 92 / 1e-25 AT2G14880 142 / 3e-44 SWIB/MDM2 domain superfamily protein (.1) Potri.013G070600 [exp] 66 / 1e-15 AT2G35605 108 / 2e-31 SWIB/MDM2 domain superfamily protein (.1) Potri.004G145200 [exp] 52 / 1e-09 AT1G49520 308 / 6e-103 SWIB complex BAF60b domain-containing protein (.1) Potri.009G106700 [exp] 52 / 2e-09 AT1G49520 301 / 5e-100 SWIB complex BAF60b domain-containing protein (.1) Potri.015G137600 [exp] 49 / 2e-09 AT4G26810 181 / 1e-60 SWIB/MDM2 domain superfamily protein (.1.2) Potri.005G134500 [exp] 47 / 1e-07 AT3G19080 226 / 3e-70 SWIB complex BAF60b domain-containing protein (.1) Potri.006G010700 [exp] 42 / 7e-06 AT4G22360 303 / 2e-100 SWIB complex BAF60b domain-containing protein (.1) Potri.016G013400 [exp] 41 / 9e-06 AT4G22360 301 / 1e-99 SWIB complex BAF60b domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02201 [flax] [poplar] SWIB SWIB/MDM2 domain
Representative CDS sequence Show only first row Show all	>Lus10002106 pacid=23166356 polypeptide=Lus10002106 locus=Lus10002106.g ID=Lus10002106.BGIv1.0 annot-version=v1.0 ATGGCGGAGCTCGTCGGCGTCCCTGAAATCTCCCGCACCCAGGCTCTTAAGTCCATTTGGAGCTATATCAAGGAGCACAATCTCCAGGACCCAGAGAACA AGAAGATCATAAAATGTGATGACAAGCTGAAGAAGATATTCGCAGGAAAAGATCAGATTGGATTCCTGGAGATTGCCGGGTTAATTACCCCACACTTTCT CAAGTGA
AA sequence Show only first row Show all	>Lus10002106 pacid=23166356 polypeptide=Lus10002106 locus=Lus10002106.g ID=Lus10002106.BGIv1.0 annot-version=v1.0 MAELVGVPEISRTQALKSIWSYIKEHNLQDPENKKIIKCDDKLKKIFAGKDQIGFLEIAGLITPHFLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34290			SWIB/MDM2 domain superfamily p...		Lus10002106 [exp]	0	1
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Lus10024430 [exp]	1.7	0.9500
AT5G58250		EMB3143	EMBRYO DEFECTIVE 3143, unknown...		Lus10035110 [exp]	2.0	0.9457
AT2G14880			SWIB/MDM2 domain superfamily p...		Lus10013893 [exp]	5.3	0.9135
AT5G27390			Mog1/PsbP/DUF1795-like photosy...		Lus10015165 [exp]	5.5	0.9160
AT5G27390			Mog1/PsbP/DUF1795-like photosy...		Lus10031517 [exp]	6.3	0.8979
AT1G02560		NCLPP5, NCLPP1,...	NUCLEAR CLPP 5, NUCLEAR-ENCODE...		Lus10002422 [exp]	8.2	0.8719
AT2G20020		CAF1, ATCAF1	RNA-binding CRS1 / YhbY (CRM) ...		Lus10011119 [exp]	8.5	0.8503
AT3G46630			Protein of unknown function (D...		Lus10024797 [exp]	11.2	0.9014
					Lus10040882 [exp]	14.1	0.9053
AT3G52380		CP33, PDE322	PIGMENT DEFECTIVE 322, chlorop...		Lus10016174 [exp]	14.3	0.9067

Compare expression of checked genes

Lus10002106 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.