Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19550 78 / 1e-20 unknown protein AT1G73120 41 / 3e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002115 [exp] 129 / 1e-41 AT3G19550 77 / 2e-20 unknown protein Lus10013901 [exp] 126 / 1e-39 AT3G19550 79 / 4e-20 unknown protein Lus10013900 [exp] 57 / 2e-12 AT3G19550 50 / 6e-09 unknown protein Lus10022961 [exp] 45 / 8e-08 AT1G73120 64 / 2e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G296900 [exp] 88 / 1e-24 AT3G19550 83 / 7e-22 unknown protein Potri.009G091100 [exp] 79 / 3e-21 AT3G19550 84 / 2e-22 unknown protein Potri.010G248600 [exp] 42 / 2e-06 AT1G73120 102 / 3e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002114 pacid=23166358 polypeptide=Lus10002114 locus=Lus10002114.g ID=Lus10002114.BGIv1.0 annot-version=v1.0 ATGTGGGTGCCGGATCCTCGAACGGGGATATACTTTCCGAGAGGGCAGGAATGGGTGATGGAGGATGTGCCGGATAACGCAGCCCTTTTCGGGCAGAGTT ACTGGCTCAGGAACGTCGACGGCGTTGAGAAACCCGACCCGGATCACGCCTCCAATGCTGACCGTTATGGACTTTTTGGGACTTGA
AA sequence Show only first row Show all	>Lus10002114 pacid=23166358 polypeptide=Lus10002114 locus=Lus10002114.g ID=Lus10002114.BGIv1.0 annot-version=v1.0 MWVPDPRTGIYFPRGQEWVMEDVPDNAALFGQSYWLRNVDGVEKPDPDHASNADRYGLFGT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19550			unknown protein		Lus10002114 [exp]	0	1
AT3G19550			unknown protein		Lus10002115 [exp]	1.0	0.9982
AT3G19550			unknown protein		Lus10013901 [exp]	2.0	0.9951
AT1G50380			Prolyl oligopeptidase family p...		Lus10032964 [exp]	3.0	0.9918
					Lus10038743 [exp]	3.5	0.9907
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Lus10035974 [exp]	4.5	0.9884
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Lus10034790 [exp]	4.9	0.9875
AT2G16630			Pollen Ole e 1 allergen and ex...		Lus10026279 [exp]	5.5	0.9655
AT1G74220			unknown protein		Lus10040518 [exp]	7.5	0.9752
AT3G26510			Octicosapeptide/Phox/Bem1p fam...		Lus10006214 [exp]	8.3	0.9380
AT5G07050			nodulin MtN21 /EamA-like trans...		Lus10041634 [exp]	8.7	0.9414

Compare expression of checked genes

Lus10002114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.