Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19620 81 / 5e-19 Glycosyl hydrolase family protein (.1) AT5G64570 68 / 3e-14 ATBXL4, XYL4 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1) AT5G10560 63 / 1e-12 Glycosyl hydrolase family protein (.1) AT5G09700 61 / 9e-12 Glycosyl hydrolase family protein (.1) AT5G49360 60 / 2e-11 ATBXL1, BXL1 beta-xylosidase 1 (.1) AT5G09730 56 / 4e-10 ATBXL3, XYL3, BXL3, ATBX3 beta-xylosidase 3 (.1) AT1G02640 51 / 2e-08 ATBXL2, BXL2 beta-xylosidase 2 (.1) AT1G78060 50 / 3e-08 Glycosyl hydrolase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020966 [exp] 73 / 5e-16 AT5G64570 1181 / 0.0 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1) Lus10019099 [exp] 62 / 3e-12 AT1G78060 1007 / 0.0 Glycosyl hydrolase family protein (.1) Lus10007775 [exp] 60 / 2e-11 AT1G78060 725 / 0.0 Glycosyl hydrolase family protein (.1) Lus10022374 [exp] 60 / 2e-11 AT1G78060 1065 / 0.0 Glycosyl hydrolase family protein (.1) Lus10019240 [exp] 59 / 4e-11 AT5G10560 407 / 1e-133 Glycosyl hydrolase family protein (.1) Lus10004271 [exp] 58 / 9e-11 AT5G10560 989 / 0.0 Glycosyl hydrolase family protein (.1) Lus10010015 [exp] 57 / 1e-10 AT1G02640 1148 / 0.0 beta-xylosidase 2 (.1) Lus10016858 [exp] 53 / 7e-09 AT5G49360 922 / 0.0 beta-xylosidase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G294700 [exp] 81 / 8e-19 AT3G19620 1080 / 0.0 Glycosyl hydrolase family protein (.1) Potri.003G022900 [exp] 70 / 7e-15 AT5G64570 1138 / 0.0 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1) Potri.001G089100 [exp] 63 / 1e-12 AT5G10560 988 / 0.0 Glycosyl hydrolase family protein (.1) Potri.002G094000 [exp] 62 / 4e-12 AT1G78060 1077 / 0.0 Glycosyl hydrolase family protein (.1) Potri.001G206800 [exp] 61 / 6e-12 AT5G64570 1168 / 0.0 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1) Potri.010G141400 [exp] 60 / 1e-11 AT5G49360 1113 / 0.0 beta-xylosidase 1 (.1) Potri.008G108100 [exp] 59 / 3e-11 AT5G49360 1104 / 0.0 beta-xylosidase 1 (.1) Potri.005G168500 [exp] 58 / 7e-11 AT1G78060 1069 / 0.0 Glycosyl hydrolase family protein (.1) Potri.002G093900 [exp] 57 / 2e-10 AT1G78060 1069 / 0.0 Glycosyl hydrolase family protein (.1) Potri.014G122200 [exp] 56 / 4e-10 AT1G02640 1154 / 0.0 beta-xylosidase 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002127 pacid=23166348 polypeptide=Lus10002127 locus=Lus10002127.g ID=Lus10002127.BGIv1.0 annot-version=v1.0 ATGACAGACATGAACATGAGAGCTAATGCAACTTCCAACTACCCAGGAAGGACATACAGATTCTACACGGGAAAACCAATCCAAGTATTCGGCCGTGGCC TCAGCTACTCACCTTTCACCAAATCAATCATCCCTGCTGTCCCTTCTTCAACTCTGCTTATCCATTTGAACGATTCATCCATCATAAATACCGCGGCTAG CCAATCCATCGACGTTTCGGACATTGCAAAACTGCAAGGAGCTACAAATAAAGGTGGTGGTGGAGGTGAAGAACACAGGGGACATGGACGGGGACCATGT GGTGCTGGTGTTCTGGAGCCCTCCAAAGGGTTCGGAAAACGTGACAGCTGGACAGCCGAGTAA
AA sequence Show only first row Show all	>Lus10002127 pacid=23166348 polypeptide=Lus10002127 locus=Lus10002127.g ID=Lus10002127.BGIv1.0 annot-version=v1.0 MTDMNMRANATSNYPGRTYRFYTGKPIQVFGRGLSYSPFTKSIIPAVPSSTLLIHLNDSSIINTAASQSIDVSDIAKLQGATNKGGGGGEEHRGHGRGPC GAGVLEPSKGFGKRDSWTAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19620			Glycosyl hydrolase family prot...		Lus10002127 [exp]	0	1
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10028717 [exp]	1.4	0.9673
AT4G26400			RING/U-box superfamily protein...		Lus10006449 [exp]	2.0	0.9673
					Lus10026713 [exp]	7.1	0.9451
					Lus10021851 [exp]	9.2	0.9383
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10004530 [exp]	10.2	0.9383
AT4G21870			HSP20-like chaperones superfam...		Lus10018346 [exp]	10.4	0.7851
					Lus10008791 [exp]	11.2	0.9383
					Lus10012440 [exp]	12.1	0.9383
					Lus10031183 [exp]	13.0	0.9301
AT5G58380		PKS2, CIPK10, S...	SNF1-RELATED PROTEIN KINASE 3....		Lus10030546 [exp]	13.7	0.9300

Compare expression of checked genes

Lus10002127 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.