Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09730 92 / 6e-23 ATBXL3, XYL3, BXL3, ATBX3 beta-xylosidase 3 (.1) AT5G49360 92 / 1e-22 ATBXL1, BXL1 beta-xylosidase 1 (.1) AT5G64570 91 / 2e-22 ATBXL4, XYL4 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1) AT1G02640 89 / 7e-22 ATBXL2, BXL2 beta-xylosidase 2 (.1) AT1G78060 80 / 2e-18 Glycosyl hydrolase family protein (.1) AT5G10560 60 / 1e-11 Glycosyl hydrolase family protein (.1) AT5G09700 44 / 4e-06 Glycosyl hydrolase family protein (.1) AT3G19620 0 / 1 Glycosyl hydrolase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020966 [exp] 100 / 2e-25 AT5G64570 1181 / 0.0 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1) Lus10010015 [exp] 98 / 7e-25 AT1G02640 1148 / 0.0 beta-xylosidase 2 (.1) Lus10016858 [exp] 95 / 1e-23 AT5G49360 922 / 0.0 beta-xylosidase 1 (.1) Lus10019099 [exp] 76 / 5e-17 AT1G78060 1007 / 0.0 Glycosyl hydrolase family protein (.1) Lus10007775 [exp] 72 / 6e-16 AT1G78060 725 / 0.0 Glycosyl hydrolase family protein (.1) Lus10022374 [exp] 72 / 6e-16 AT1G78060 1065 / 0.0 Glycosyl hydrolase family protein (.1) Lus10004271 [exp] 65 / 4e-13 AT5G10560 989 / 0.0 Glycosyl hydrolase family protein (.1) Lus10025036 [exp] 52 / 4e-09 AT5G09730 182 / 4e-53 beta-xylosidase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G294700 [exp] 108 / 2e-28 AT3G19620 1080 / 0.0 Glycosyl hydrolase family protein (.1) Potri.001G206800 [exp] 100 / 7e-26 AT5G64570 1168 / 0.0 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1) Potri.002G197200 [exp] 95 / 8e-24 AT1G02640 1189 / 0.0 beta-xylosidase 2 (.1) Potri.014G122200 [exp] 94 / 1e-23 AT1G02640 1154 / 0.0 beta-xylosidase 2 (.1) Potri.003G022900 [exp] 86 / 1e-20 AT5G64570 1138 / 0.0 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1) Potri.010G141400 [exp] 85 / 2e-20 AT5G49360 1113 / 0.0 beta-xylosidase 1 (.1) Potri.007G114300 [exp] 76 / 3e-17 AT3G19620 776 / 0.0 Glycosyl hydrolase family protein (.1) Potri.008G108100 [exp] 73 / 3e-16 AT5G49360 1104 / 0.0 beta-xylosidase 1 (.1) Potri.005G168500 [exp] 72 / 5e-16 AT1G78060 1069 / 0.0 Glycosyl hydrolase family protein (.1) Potri.002G093900 [exp] 71 / 1e-15 AT1G78060 1069 / 0.0 Glycosyl hydrolase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00933 [flax] [poplar] Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
Representative CDS sequence Show only first row Show all	>Lus10002128 pacid=23166352 polypeptide=Lus10002128 locus=Lus10002128.g ID=Lus10002128.BGIv1.0 annot-version=v1.0 ATGAAAGGATACACGCCTAGCGGCAACTACCAACTGGGAAGCTTAAGGTTTCAAGCTGCTGCAAGCACAATACAGCTTATGATCTTGATAACTGGAAAGA TGTTGATAGGTTCCATTTTGATGCTAAGAGTGAATGGTATTCCAACTTGTGCTGATCCTGATTTGCTTAAAGGAGTTGTCAGAGGCCAATGGAATCTTAA TGGATACATAGTCTCAGATTGTGACTCTATTGAGGTTTACTACAATAGCATTCATTACACGCCCACTCCAGAAGATGCAGTAGCCCTTGCACTCAAAGCA GCTAATATTCCTTCCAATTTTCGATTCTGGGTGGAATGA
AA sequence Show only first row Show all	>Lus10002128 pacid=23166352 polypeptide=Lus10002128 locus=Lus10002128.g ID=Lus10002128.BGIv1.0 annot-version=v1.0 MKGYTPSGNYQLGSLRFQAAASTIQLMILITGKMLIGSILMLRVNGIPTCADPDLLKGVVRGQWNLNGYIVSDCDSIEVYYNSIHYTPTPEDAVALALKA ANIPSNFRFWVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19620			Glycosyl hydrolase family prot...		Lus10002128 [exp]	0	1
					Lus10036535 [exp]	1.0	0.9972
AT3G01650		RGLG1	RING domain ligase1 (.1)		Lus10015079 [exp]	1.4	0.9963
AT4G15550		IAGLU	indole-3-acetate beta-D-glucos...		Lus10027584 [exp]	4.5	0.9346
AT2G47485			unknown protein		Lus10036328 [exp]	18.8	0.9039
AT1G02050		LAP6	LESS ADHESIVE POLLEN 6, Chalco...		Lus10039904 [exp]	20.6	0.9280
					Lus10013528 [exp]	22.9	0.9593
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10003792 [exp]	25.8	0.9273
					Lus10036646 [exp]	26.5	0.9556
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Lus10001543 [exp]	28.5	0.9222
AT3G28910	MYB	AtMYB30, MYB30	myb domain protein 30 (.1)		Lus10015369 [exp]	30.5	0.9139

Compare expression of checked genes

Lus10002128 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.