Lus10002145 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07525 84 / 3e-20 ATG10, ATATG10 autophagy 10, autophagocytosis-associated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008745 221 / 3e-73 AT3G07525 209 / 4e-68 autophagy 10, autophagocytosis-associated family protein (.1.2)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0097 TypeIII_Chap PF03987 Autophagy_act_C Autophagocytosis associated protein, active-site domain
Representative CDS sequence
>Lus10002145 pacid=23181290 polypeptide=Lus10002145 locus=Lus10002145.g ID=Lus10002145.BGIv1.0 annot-version=v1.0
ATGAGGACAGGAAAAGTACCTAAAGACCAACAAAGACAGCACACACGCAGAATGCCTGCAACCGGAGACGAACGGAGGCCTATATTCTCCAGCGACGAAG
CTCCAGAAACCCTAGAAATTGCAGAGAATTGGAGCGAGTTCGCAGCATTTGCTAGAGCTTTTGCTAAGAAATGGAAGCTGCTAAATAACCCTGATTTCCC
TTCCTGGGTATGGGGCAATTCCCCCAAAGCGTCACTCTTTGCTTCTCCCCATCAAGTGGATGAAGAAGGGTACCTATCACTGGAGAATATATGTATCGTG
AAGTCAACCAAGGTTGATGAAGTTGTTTCCTTAACGGAAGCAGGGACGAGTTTAGCAGCCGACTCTGCAACCTTGGTTGAAAGCAGTGATCTTGATAAGT
TGCATCACTACTTTGATCTGCACATAATCTACAGTGCTTCATCCAGGGTTCCAGTGCTATACTTCCGTGCATATTCCAGTGATGGGGGGAACTTTGGTTT
AAATGAGATTGAAAGAGCTCTTCCTGCTAACTCTGTCAAGTTCTTGTGA
AA sequence
>Lus10002145 pacid=23181290 polypeptide=Lus10002145 locus=Lus10002145.g ID=Lus10002145.BGIv1.0 annot-version=v1.0
MRTGKVPKDQQRQHTRRMPATGDERRPIFSSDEAPETLEIAENWSEFAAFARAFAKKWKLLNNPDFPSWVWGNSPKASLFASPHQVDEEGYLSLENICIV
KSTKVDEVVSLTEAGTSLAADSATLVESSDLDKLHHYFDLHIIYSASSRVPVLYFRAYSSDGGNFGLNEIERALPANSVKFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07525 ATG10, ATATG10 autophagy 10, autophagocytosis... Lus10002145 0 1
AT5G48905 LCR12 low-molecular-weight cysteine-... Lus10021078 3.0 0.8675
AT5G47520 AtRABA5a RAB GTPase homolog A5A (.1) Lus10000047 6.2 0.7755
AT5G66680 DGL1 DEFECTIVE GLYCOSYLATION, dolic... Lus10009792 6.9 0.8017
AT2G17695 unknown protein Lus10028386 8.5 0.8558
AT5G18750 DNAJ heat shock N-terminal dom... Lus10032539 9.2 0.8499
AT5G55760 SRT1 sirtuin 1 (.1) Lus10016619 10.2 0.8497
AT1G79915 Putative methyltransferase fam... Lus10025778 11.0 0.8106
AT3G09860 unknown protein Lus10001400 13.2 0.8315
AT3G15180 ARM repeat superfamily protein... Lus10038999 17.1 0.7906
AT2G40435 unknown protein Lus10017415 18.0 0.8171

Lus10002145 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.