Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02630 95 / 4e-25 Nucleoside transporter family protein (.1.2) AT1G70330 77 / 2e-18 "ENT1,AT", ENT1,AT, ATENT1 equilibrative nucleotide transporter 1 (.1) AT1G61630 48 / 3e-08 ATENT7 equilibrative nucleoside transporter 7 (.1) AT4G05110 45 / 2e-07 ATENT6 equilibrative nucleoside transporter 6 (.1) AT4G05120 45 / 2e-07 FUR1, ENT3, FLUOROURIDINEINSENSITIVE1, ATENT3 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) AT4G05130 42 / 4e-06 ATENT4 equilibrative nucleoside transporter 4 (.1) AT4G05140 41 / 6e-06 Nucleoside transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030104 [exp] 111 / 3e-31 AT1G02630 526 / 0.0 Nucleoside transporter family protein (.1.2) Lus10029162 [exp] 80 / 2e-19 AT1G70330 551 / 0.0 equilibrative nucleotide transporter 1 (.1) Lus10013002 [exp] 64 / 6e-14 AT1G70330 534 / 0.0 equilibrative nucleotide transporter 1 (.1) Lus10039741 [exp] 48 / 3e-08 AT4G05120 580 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10018413 [exp] 47 / 5e-08 AT4G05120 606 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10002589 [exp] 47 / 5e-08 AT4G05120 609 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10018523 [exp] 47 / 9e-08 AT4G05120 579 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G130200 [exp] 90 / 9e-25 AT1G02630 212 / 5e-68 Nucleoside transporter family protein (.1.2) Potri.018G130000 [exp] 91 / 2e-23 AT1G02630 452 / 5e-159 Nucleoside transporter family protein (.1.2) Potri.006G068100 [exp] 78 / 4e-19 AT1G02630 432 / 6e-151 Nucleoside transporter family protein (.1.2) Potri.012G058900 [exp] 63 / 1e-13 AT1G70330 530 / 0.0 equilibrative nucleotide transporter 1 (.1) Potri.004G032400 [exp] 44 / 1e-06 AT4G05120 584 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Potri.019G118400 [exp] 39 / 5e-05 AT4G05120 520 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Potri.004G032300 [exp] 39 / 6e-05 AT4G05120 586 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Potri.011G041112 [exp] 38 / 9e-05 AT4G05120 540 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Potri.004G032500 [exp] 37 / 0.0001 AT4G05120 457 / 2e-160 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0015 [flax] [poplar] MFS PF01733 [flax] [poplar] Nucleoside_tran Nucleoside transporter
Representative CDS sequence Show only first row Show all	>Lus10002167 pacid=23180824 polypeptide=Lus10002167 locus=Lus10002167.g ID=Lus10002167.BGIv1.0 annot-version=v1.0 ATGGCTCTAACCTTCATGCTCGGCATCACAAATGGGTATTTGACAAGTGTTCTTATGATTCTCGCCCCAAAATCAGTTCCAGGTTCAGAGGCAGAGTTGG CTGCAATTGTGATGGTTGTATTCCTCGGGATTGGCTTAGTCTGTGGATCTGTGCTTGGCTGGTTTTGGATCATATGA
AA sequence Show only first row Show all	>Lus10002167 pacid=23180824 polypeptide=Lus10002167 locus=Lus10002167.g ID=Lus10002167.BGIv1.0 annot-version=v1.0 MALTFMLGITNGYLTSVLMILAPKSVPGSEAELAAIVMVVFLGIGLVCGSVLGWFWII

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G02630			Nucleoside transporter family ...		Lus10002167 [exp]	0	1
AT2G01290		RPI2	ribose-5-phosphate isomerase 2...		Lus10036094 [exp]	1.0	0.9091
AT1G03750		SWI2, SNF2, CHR...	CHROMATIN REMODELING 9, switch...		Lus10017712 [exp]	3.3	0.8677
AT4G18780		LEW2, IRX1, ATC...	LEAF WILTING 2, IRREGULAR XYLE...		Lus10022449 [exp]	5.5	0.8908
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10039429 [exp]	7.9	0.8775
AT1G27170			transmembrane receptors;ATP bi...		Lus10032101 [exp]	8.9	0.8712
AT1G69580	GARP		Homeodomain-like superfamily p...		Lus10036758 [exp]	11.7	0.8737
AT3G47570			Leucine-rich repeat protein ki...		Lus10030630 [exp]	12.4	0.8740
AT3G05170			Phosphoglycerate mutase family...		Lus10032291 [exp]	12.6	0.8701
AT2G24220		ATPUP5	purine permease 5 (.1.2)		Lus10022148 [exp]	12.8	0.8452
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Lus10020729 [exp]	13.2	0.8717

Compare expression of checked genes

Lus10002167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.