Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20585 71 / 2e-17 NFD6 nuclear fusion defective 6 (.1.2.3) AT1G28395 65 / 5e-15 unknown protein AT2G33847 60 / 3e-13 unknown protein AT1G55205 47 / 4e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039888 [exp] 117 / 2e-35 AT2G20585 77 / 2e-19 nuclear fusion defective 6 (.1.2.3) Lus10029157 [exp] 48 / 3e-08 AT1G70350 59 / 2e-12 unknown protein Lus10013008 [exp] 47 / 9e-08 AT1G70350 59 / 3e-12 unknown protein Lus10023655 [exp] 40 / 1e-05 AT1G55205 83 / 3e-22 unknown protein Lus10024700 [exp] 40 / 7e-05 AT1G55205 80 / 4e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G137500 [exp] 84 / 2e-22 AT2G20585 66 / 1e-15 nuclear fusion defective 6 (.1.2.3) Potri.004G048100 [exp] 80 / 7e-21 AT1G28395 91 / 1e-25 unknown protein Potri.011G057300 [exp] 74 / 1e-18 AT1G28395 103 / 2e-30 unknown protein Potri.017G014500 [exp] 72 / 4e-18 AT2G20585 72 / 5e-18 nuclear fusion defective 6 (.1.2.3) Potri.006G237800 [exp] 39 / 5e-05 AT5G11630 99 / 8e-29 unknown protein Potri.017G068600 [exp] 37 / 0.0003 AT4G17310 94 / 2e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002171 pacid=23158745 polypeptide=Lus10002171 locus=Lus10002171.g ID=Lus10002171.BGIv1.0 annot-version=v1.0 ATGGCCACCTTCGCCGCCGCCGCTGCCGGGAGATCCATTTTCCGTTCAACGTCGTCCTCTGCTCGCAATGCGGCGGCTCGGTTCGCCTCCCAGACCAAGG CGGCTCCAAAATCCTCTCCGAGCTCTGCTTTCCGTACTTCCGCCAACAAGCCTGCATCTCAATCCACTTTCAGGCTTCCAGTGGAGATGAGCTTTGCAGT GGAATCGATGATGCCGTACCACACTGTGACTGCTTCAGCTTTGATGACCTCGATGCTTTCCATCTCTCAGCGTAGCTATGGATGGCTTCCTGAAGGTTAA
AA sequence Show only first row Show all	>Lus10002171 pacid=23158745 polypeptide=Lus10002171 locus=Lus10002171.g ID=Lus10002171.BGIv1.0 annot-version=v1.0 MATFAAAAAGRSIFRSTSSSARNAAARFASQTKAAPKSSPSSAFRTSANKPASQSTFRLPVEMSFAVESMMPYHTVTASALMTSMLSISQRSYGWLPEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20585		NFD6	nuclear fusion defective 6 (.1...		Lus10002171 [exp]	0	1
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10014035 [exp]	2.0	0.9530
AT1G74270			Ribosomal protein L35Ae family...		Lus10027754 [exp]	5.5	0.9456
AT3G25520		PGY3, ATL5, OLI...	RIBOSOMAL PROTEIN L5 A, PIGGYB...		Lus10004874 [exp]	6.5	0.9488
AT3G06700			Ribosomal L29e protein family ...		Lus10037740 [exp]	7.5	0.9474
AT4G09320		NDPK1	Nucleoside diphosphate kinase ...		Lus10003844 [exp]	7.9	0.9477
AT2G43360		BIOB, BIO2	BIOTIN AUXOTROPH B, BIOTIN AUX...		Lus10027018 [exp]	8.5	0.9283
AT4G14320			Zinc-binding ribosomal protein...		Lus10017396 [exp]	10.5	0.9332
AT3G06700			Ribosomal L29e protein family ...		Lus10016875 [exp]	11.2	0.9421
AT2G20450			Ribosomal protein L14 (.1)		Lus10021170 [exp]	12.4	0.9388
AT2G03590		ATUPS1	ureide permease 1 (.1)		Lus10037074 [exp]	15.6	0.9343

Compare expression of checked genes

Lus10002171 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.