Lus10002174 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28000 50 / 5e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28010 49 / 9e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G35260 42 / 2e-05 MLP165 MLP-like protein 165 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039891 283 / 7e-100 AT5G28010 59 / 3e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10002175 235 / 1e-80 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039863 152 / 7e-48 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039864 136 / 2e-40 AT5G54160 65 / 7e-12 O-methyltransferase 1 (.1)
Lus10039892 119 / 9e-36 ND 41 / 9e-06
Lus10018627 96 / 2e-26 ND /
Lus10002176 83 / 1e-20 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2)
Lus10039893 53 / 4e-10 AT1G70870 53 / 1e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10030840 45 / 2e-06 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G051100 40 / 0.0002 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.004G020000 39 / 0.0005 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10002174 pacid=23158725 polypeptide=Lus10002174 locus=Lus10002174.g ID=Lus10002174.BGIv1.0 annot-version=v1.0
ATGGCGGCTCAGACTCACAAGCTAGAGGTTAAGGTAACAATGAAATCACCAGAGAAGCTGGTGTCTTTCTACATAAACCATGTCCTCGAAACGCCAAAAC
TGGCTCCTGCGATCATCAAGGCATGCGAGACCATCGGAGGAGGCACCCAGATGGGTCCCGGCTCCGTTTTCCACGTCACTTACATCCTCCCTGGGATGAC
TGAGGTGGTGAGTGCCAAGGGAATGTTGGGAGATGTAGACGAAGTAGGAGGGAAGTACTTGTCATTCACGGTGATCGAAGGGGAGATGTTACAGAAGTAT
CCTACTTTCATCTCAAGAGCTACCATTGTCGGCAACGAGATTACCTGGACTCTCATGTACGAGAAGGCAGATCCGAGCACCCTTCCTCCTCTCGAATATG
TTACACTTTATACGCTCCTTACCCAAGCCTTCGACAACTTCAATTGCTGA
AA sequence
>Lus10002174 pacid=23158725 polypeptide=Lus10002174 locus=Lus10002174.g ID=Lus10002174.BGIv1.0 annot-version=v1.0
MAAQTHKLEVKVTMKSPEKLVSFYINHVLETPKLAPAIIKACETIGGGTQMGPGSVFHVTYILPGMTEVVSAKGMLGDVDEVGGKYLSFTVIEGEMLQKY
PTFISRATIVGNEITWTLMYEKADPSTLPPLEYVTLYTLLTQAFDNFNC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28010 Polyketide cyclase/dehydrase a... Lus10002174 0 1
AT1G54730 Major facilitator superfamily ... Lus10033815 2.0 0.9446
AT3G09870 SAUR-like auxin-responsive pro... Lus10004014 2.6 0.9545
AT2G36830 TIP1;1, GAMMA-T... TONOPLAST INTRINSIC PROTEIN 1;... Lus10014411 5.3 0.9419
AT5G64440 ATFAAH fatty acid amide hydrolase (.1... Lus10016685 6.5 0.9432
AT1G17200 Uncharacterised protein family... Lus10026196 7.1 0.9266
AT3G24420 alpha/beta-Hydrolases superfam... Lus10033087 8.4 0.9285
AT1G09310 Protein of unknown function, D... Lus10031428 9.2 0.9355
AT5G41410 HD BEL1 BELL 1, POX (plant homeobox) f... Lus10028770 10.3 0.8776
AT1G17200 Uncharacterised protein family... Lus10042471 11.8 0.9414
AT5G02890 HXXXD-type acyl-transferase fa... Lus10000592 13.7 0.9245

Lus10002174 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.