Lus10002175 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28010 50 / 5e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70840 44 / 5e-06 MLP31 MLP-like protein 31 (.1)
AT1G70870 44 / 6e-06 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70850 39 / 0.0007 MLP34 MLP-like protein 34 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039891 243 / 8e-84 AT5G28010 59 / 3e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10002174 235 / 9e-81 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039863 163 / 2e-52 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039864 144 / 2e-43 AT5G54160 65 / 7e-12 O-methyltransferase 1 (.1)
Lus10039892 137 / 6e-43 ND 41 / 9e-06
Lus10018627 104 / 5e-30 ND /
Lus10002176 91 / 1e-23 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2)
Lus10039893 52 / 1e-09 AT1G70870 53 / 1e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10028887 52 / 6e-09 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G051100 42 / 2e-05 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.008G131200 42 / 2e-05 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.004G020000 38 / 0.0007 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10002175 pacid=23158742 polypeptide=Lus10002175 locus=Lus10002175.g ID=Lus10002175.BGIv1.0 annot-version=v1.0
ATGGCGGCTCAGATTCACAAGTTAGAGGTCAAGGTTGCGATGAAATCGCCAGAGAAGCTGGTGTCTTTCTTCAGGAACCATCTCCTCGATATGCCAAAAC
TTGCTCCTGCTATCGTCAAGTCATGCGAGATCATCGGCGGAGGCACCCAGATGGGTCCAGGCTCTCGTCTCAGTGTCACTTACACCATCCCTGGGATGGC
TCAGCTGTTGAGTGCCAAAGCAACGATGGAAGATGTAGATGAAGTGGGAGGGAAGTACATGACAGTGGCGGTGACCGAAGGGGACATATTGCAGAAGTAT
CCTACTTACGTCTCCAAAGCTGTGATCATCGGCAACGAGGTTACCTGGACTGTCGAGTACGAGAAGGCCGATTCGACCACTCTTCCTCCTCTCGAATATG
TTCCACTTTACACACTCCTCACCCAAGCCTTTGACAACTTCAACTACTGA
AA sequence
>Lus10002175 pacid=23158742 polypeptide=Lus10002175 locus=Lus10002175.g ID=Lus10002175.BGIv1.0 annot-version=v1.0
MAAQIHKLEVKVAMKSPEKLVSFFRNHLLDMPKLAPAIVKSCEIIGGGTQMGPGSRLSVTYTIPGMAQLLSAKATMEDVDEVGGKYMTVAVTEGDILQKY
PTYVSKAVIIGNEVTWTVEYEKADSTTLPPLEYVPLYTLLTQAFDNFNY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28010 Polyketide cyclase/dehydrase a... Lus10002175 0 1
AT1G66920 Protein kinase superfamily pro... Lus10025547 2.6 0.9091
Lus10010378 3.0 0.9490
AT2G45760 BAL, BAP2 BON ASSOCIATION PROTEIN 1-LIKE... Lus10008004 4.2 0.9101
AT1G07400 HSP20-like chaperones superfam... Lus10021503 6.0 0.9175
AT5G55480 GPDL1, GDPDL4, ... glycerophosphodiesterase-like ... Lus10018042 7.4 0.9119
Lus10032860 8.7 0.9255
AT1G78410 VQ motif-containing protein (.... Lus10038502 9.8 0.8954
Lus10021726 10.6 0.8776
AT4G15210 BAM5, AT-BETA-A... REDUCED BETA AMYLASE 1, ARABID... Lus10039702 13.0 0.9123
AT5G10530 Concanavalin A-like lectin pro... Lus10007073 13.3 0.8826

Lus10002175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.