Lus10002176 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24020 65 / 1e-13 MLP423 MLP-like protein 423 (.1.2)
AT1G70830 61 / 3e-12 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G70840 59 / 3e-11 MLP31 MLP-like protein 31 (.1)
AT1G70870 57 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70850 57 / 2e-10 MLP34 MLP-like protein 34 (.1.2.3)
AT5G28010 56 / 4e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G35260 51 / 1e-08 MLP165 MLP-like protein 165 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039893 128 / 2e-39 AT1G70870 53 / 1e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10002175 100 / 2e-27 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039863 98 / 1e-26 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10002174 92 / 4e-24 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039891 91 / 1e-23 AT5G28010 59 / 3e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039864 82 / 2e-19 AT5G54160 65 / 7e-12 O-methyltransferase 1 (.1)
Lus10030646 74 / 6e-17 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2)
Lus10030840 72 / 1e-16 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2)
Lus10018627 65 / 3e-14 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G096000 69 / 2e-15 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2)
Potri.008G131300 62 / 9e-13 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.004G020100 49 / 9e-08 AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.017G051100 48 / 2e-07 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.004G020000 48 / 2e-07 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G111000 44 / 5e-06 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5)
Potri.017G051200 40 / 0.0001 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10002176 pacid=23158741 polypeptide=Lus10002176 locus=Lus10002176.g ID=Lus10002176.BGIv1.0 annot-version=v1.0
ATGGCTCAGCTTGTGAAGATTGAGGCCAGAGTTTCGATTAAGAATCCGGACAAGCTCATGAATTTCCTCAAGAACAACCTCCACACCTTGCCTCAGCTGT
TCCCTGATGCCTACAAGAGCGTTGAGATCCGAGGAGGAGGTGGCCGCAGCGGTAGCCAGCTGACAACCGGATCCATCATCATGCTCACCTACTCTCTCCC
TGGGGACTCGGCGCCATTACCGAACAGCTTGATGAGAGGGGAAGTGAAGGTGGAAGCAATGGACGAAGCAATGAAGTCGATAACGTTGAATGTGGTAGGC
GGCGATGGGCTCAAGACTTACACAAGTTTCAGGTCGAAATGCCAAATTGTTGGGAACATTGTGAATTGGAGCATCGAGTACGAGAAGGCTACTCCTTCTT
CACCGTCTGCTGACCCTTATTTGGAGTTTTACGTCAAACTCTCCAAGACCATCGACATATAA
AA sequence
>Lus10002176 pacid=23158741 polypeptide=Lus10002176 locus=Lus10002176.g ID=Lus10002176.BGIv1.0 annot-version=v1.0
MAQLVKIEARVSIKNPDKLMNFLKNNLHTLPQLFPDAYKSVEIRGGGGRSGSQLTTGSIIMLTYSLPGDSAPLPNSLMRGEVKVEAMDEAMKSITLNVVG
GDGLKTYTSFRSKCQIVGNIVNWSIEYEKATPSSPSADPYLEFYVKLSKTIDI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10002176 0 1
AT2G46660 CYP78A6 "cytochrome P450, family 78, s... Lus10005995 4.0 0.8652
AT1G45160 Protein kinase superfamily pro... Lus10005470 8.7 0.8929
AT5G60200 DOF TMO6, AtDof5,3 TARGET OF MONOPTEROS 6 (.1) Lus10014002 10.2 0.7517
AT4G16730 AtTPS02 terpene synthase 02 (.1) Lus10006357 11.7 0.8909
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Lus10040055 12.2 0.7041
AT4G13830 J20 DNAJ-like 20 (.1.2) Lus10019668 12.4 0.8018
AT4G37440 unknown protein Lus10019305 13.2 0.7857
AT3G46290 HERK1 hercules receptor kinase 1 (.1... Lus10012647 15.4 0.8798
AT1G05820 ATSPPL5 ARABIDOPSIS THALIANA SIGNAL PE... Lus10001154 17.3 0.7576
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10027345 17.7 0.8778

Lus10002176 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.