Lus10002178 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60860 423 / 4e-153 AtRABA1f RAB GTPase homolog A1F (.1)
AT3G15060 407 / 9e-147 AtRABA1g RAB GTPase homolog A1G (.1)
AT1G28550 397 / 8e-143 AtRABA1i RAB GTPase homolog A1I (.1)
AT2G33870 391 / 2e-140 ArRABA1h RAB GTPase homolog A1H (.1)
AT4G18430 387 / 1e-138 AtRABA1e RAB GTPase homolog A1E (.1)
AT4G18800 365 / 2e-130 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
AT5G45750 360 / 4e-128 AtRABA1c RAB GTPase homolog A1C (.1)
AT1G16920 345 / 2e-122 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
AT1G06400 343 / 1e-121 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
AT1G09630 312 / 4e-109 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017679 438 / 4e-159 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
Lus10015297 422 / 7e-153 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Lus10025432 416 / 2e-150 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Lus10039895 412 / 1e-148 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1)
Lus10013961 407 / 7e-147 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
Lus10029253 362 / 1e-128 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Lus10007306 358 / 2e-127 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1)
Lus10029789 333 / 1e-117 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Lus10020746 333 / 1e-117 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G123600 429 / 2e-155 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.019G092500 429 / 2e-155 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.001G374000 414 / 9e-150 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Potri.011G061300 413 / 4e-149 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
Potri.011G070300 361 / 1e-128 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
Potri.004G061000 359 / 7e-128 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Potri.003G004100 312 / 4e-109 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.006G000300 306 / 7e-107 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.008G061300 302 / 3e-105 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.010G197200 299 / 4e-104 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10002178 pacid=23158740 polypeptide=Lus10002178 locus=Lus10002178.g ID=Lus10002178.BGIv1.0 annot-version=v1.0
ATGGGAGCTTACAGGGCCGACGACGACTACGATTACTTGTTCAAGGTCGTCTTGATAGGCGACTCCGGCGTCGGGAAATCCAATCTCCTGTCCAGATTCA
CCAGGAACGAGTTCAGTCTCGAGTCCAAATCCACAATCGGCGTTGAATTCGCCACCCGCAGCATCCAGGTCGATGACAAGGTCGTCAAAGCCCAGATTTG
GGACACTGCTGGACAAGAAAGATATCGTGCTATCACCAGCGCATACTACAGAGGTGCAGTCGGTGCTTTGCTCGTCTACGATGTCACTCGACACGTCACA
TTTGAAAATGTGGAGAGGTGGTTAAAAGAGCTCCGTGACCACACCGATGCAAACATCGTGATCATGCTTGTTGGAAACAAGGCCGATCTTCGACACCTCC
GTGCTGTTCAGACCGAGGACTCCAAAGCATTTGCAGAGAGGGAGAACACCTTCTTCATGGAAACATCCGCCCTCGAATCCTTGAATGTCGAGAATGCCTT
TACTGAGGTGCTCACCCAGATATACCGGGTCGTCAGCCGCAAGGCCCTTGATGTCGGAGATGACCCAGCTGCCTTGCCGAAAGGACAGACTATTAACGTT
GGCAAGGATGATGTATCAGCTGTTAAGAAAGTCGGGTGCTGCTCCGCATAG
AA sequence
>Lus10002178 pacid=23158740 polypeptide=Lus10002178 locus=Lus10002178.g ID=Lus10002178.BGIv1.0 annot-version=v1.0
MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIQVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVT
FENVERWLKELRDHTDANIVIMLVGNKADLRHLRAVQTEDSKAFAERENTFFMETSALESLNVENAFTEVLTQIYRVVSRKALDVGDDPAALPKGQTINV
GKDDVSAVKKVGCCSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Lus10002178 0 1
AT1G18040 CDKD1;3, AT;CDC... cyclin-dependent kinase D1;3 (... Lus10017371 1.0 0.8687
AT5G25510 Protein phosphatase 2A regulat... Lus10033069 2.4 0.8525
AT1G53290 Galactosyltransferase family p... Lus10013683 2.6 0.8235
AT2G15730 P-loop containing nucleoside t... Lus10012072 5.0 0.8362
AT2G41820 Leucine-rich repeat protein ki... Lus10007543 5.5 0.8270
AT5G27490 Integral membrane Yip1 family ... Lus10004473 5.5 0.8172
AT1G35780 unknown protein Lus10033456 5.7 0.8226
AT5G65670 AUX_IAA IAA9 indole-3-acetic acid inducible... Lus10011583 5.8 0.8102
AT1G50710 unknown protein Lus10043109 8.1 0.8462
AT1G09000 MAPKKK1, ANP1 MAP KINASE KINASE KINASE 1, NP... Lus10015185 9.8 0.8114

Lus10002178 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.