Lus10002193 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G58100 144 / 3e-44 PDCB5 plasmodesmata callose-binding protein 5 (.1)
AT2G30933 99 / 1e-25 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT1G29380 91 / 4e-22 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G55180 89 / 3e-21 O-Glycosyl hydrolases family 17 protein (.1.2)
AT1G66870 84 / 4e-21 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G05430 84 / 4e-21 Carbohydrate-binding X8 domain superfamily protein (.1)
AT3G55430 88 / 8e-21 O-Glycosyl hydrolases family 17 protein (.1)
AT1G66855 83 / 8e-21 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G05790 87 / 2e-20 O-Glycosyl hydrolases family 17 protein (.1)
AT5G35740 82 / 2e-20 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039907 259 / 2e-89 AT3G58100 158 / 1e-49 plasmodesmata callose-binding protein 5 (.1)
Lus10012324 89 / 3e-23 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10007342 92 / 8e-23 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10031443 93 / 2e-22 AT2G30933 143 / 2e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10020765 91 / 2e-22 AT2G30933 169 / 4e-52 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10023276 88 / 4e-22 AT4G05430 146 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10038529 88 / 9e-22 AT4G05430 146 / 9e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10001516 91 / 1e-21 AT2G30933 143 / 3e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10039179 91 / 2e-21 AT3G13560 634 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G091500 171 / 1e-54 AT3G58100 145 / 2e-44 plasmodesmata callose-binding protein 5 (.1)
Potri.013G119500 145 / 6e-45 AT3G58100 128 / 6e-38 plasmodesmata callose-binding protein 5 (.1)
Potri.019G007800 97 / 1e-25 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.019G012000 97 / 1e-25 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.005G003500 102 / 2e-25 AT2G30933 142 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.013G003500 100 / 7e-25 AT1G09460 144 / 3e-38 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.002G059600 95 / 4e-24 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.006G016800 91 / 1e-23 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.017G055700 92 / 2e-23 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.007G111000 91 / 3e-23 AT4G05430 148 / 5e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Lus10002193 pacid=23158718 polypeptide=Lus10002193 locus=Lus10002193.g ID=Lus10002193.BGIv1.0 annot-version=v1.0
ATGGATTCCAAGTTCAGTCTGATACTCCTACTGCTTCTAAGCCTCTGTCTCCCGCCACTGTGGGCCGATCCGAGCGGCGCGATAGTGCCGAGGGAGCTGT
GGTGCGTGGCAAAGAACAACGCGCCAGACGCAGCGCTCCAGTCGGCGATCGACTGGGCTTGCGGTGCCGGCGGCGCGAATTGCTCTCCGATACAGCAGGG
TGGGCCCTGCTACGACGACAGCGACCTCCAGAGGGCGGCCTCATGGGCTTTCAACGACTACTTCTTGAAGAACGGGATGACTGACGACGCTTGCAACTTC
AGCAACACCGCCGCCCTCATTTCTCTCAACCCCAGCCGTGGCAATTGCAAGTTCCCTTCGAGCTCTGGTACGAGTAGCTTTTCGACAGAAACAACAATAG
GGATGGGGAGGAGCGACAGTGCAGATATGAGCAGCTGCATTAATCGCATTATTGCAGGTAGCAGCACATGGTGTTGGGGTTTGCTAGCTGGCTATAATTT
GTTTATGATCTTGTTGTTTAGATAG
AA sequence
>Lus10002193 pacid=23158718 polypeptide=Lus10002193 locus=Lus10002193.g ID=Lus10002193.BGIv1.0 annot-version=v1.0
MDSKFSLILLLLLSLCLPPLWADPSGAIVPRELWCVAKNNAPDAALQSAIDWACGAGGANCSPIQQGGPCYDDSDLQRAASWAFNDYFLKNGMTDDACNF
SNTAALISLNPSRGNCKFPSSSGTSSFSTETTIGMGRSDSADMSSCINRIIAGSSTWCWGLLAGYNLFMILLFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G58100 PDCB5 plasmodesmata callose-binding ... Lus10002193 0 1
AT2G22560 Kinase interacting (KIP1-like)... Lus10025717 3.0 0.8517
AT5G05810 ATL43 RING/U-box superfamily protein... Lus10023617 4.1 0.8120
AT1G11820 O-Glycosyl hydrolases family 1... Lus10031456 6.0 0.8451
AT3G61610 Galactose mutarotase-like supe... Lus10010131 6.6 0.8228
AT2G15480 UGT73B5 UDP-glucosyl transferase 73B5 ... Lus10026927 7.0 0.8341
AT3G12610 DRT100 DNA-DAMAGE REPAIR/TOLERATION 1... Lus10037705 7.2 0.8492
AT1G63260 TET10 tetraspanin10 (.1.2.3) Lus10002230 7.2 0.8450
AT5G27740 RFC3, EMB251, E... replication factor C 3, EMBRYO... Lus10019391 8.0 0.8315
AT3G60660 unknown protein Lus10036493 9.2 0.8186
AT3G27090 DCD (Development and Cell Deat... Lus10041557 11.6 0.7825

Lus10002193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.