Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31083 41 / 4e-06 AtCLE5, CLE5, CLE7 CLAVATA3/ESR-RELATED 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000464 [exp] 100 / 4e-29 AT2G31085 49 / 4e-09 CLAVATA3/ESR-RELATED 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G090800 [exp] 52 / 3e-10 AT2G31083 60 / 1e-13 CLAVATA3/ESR-RELATED 5 (.1) Potri.011G096900 [exp] 43 / 1e-06 AT2G31083 49 / 4e-09 CLAVATA3/ESR-RELATED 5 (.1) Potri.001G376200 [exp] 40 / 1e-05 AT2G31083 54 / 4e-11 CLAVATA3/ESR-RELATED 5 (.1) Potri.011G063750 [exp] 36 / 0.0005 AT2G31083 45 / 5e-08 CLAVATA3/ESR-RELATED 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002196 pacid=23158749 polypeptide=Lus10002196 locus=Lus10002196.g ID=Lus10002196.BGIv1.0 annot-version=v1.0 ATGGCTGCCACTAGCCAAAAAGGAAACGTGATGATACTACTGCTAGTGTTCCTGGTGGCCTCAGTCCTCATCTGCAGCTCACATGCTGCTCGCATTCTAA AGGTGCATGAGCATGAGGAGGCAGTGGCCGCGGCTCTGACAGCTGATCATCATCATCAAGATAGCAGCAGCCGGAGTAGGAGTCTGCTGAGAGAGTTGGG CTATGATGACTCCAAACTGAAGCAATATAAGAAGATATCTTCTGATAGGGTTGCACCTGGAGGACCTGATCCTCATCATCATTAA
AA sequence Show only first row Show all	>Lus10002196 pacid=23158749 polypeptide=Lus10002196 locus=Lus10002196.g ID=Lus10002196.BGIv1.0 annot-version=v1.0 MAATSQKGNVMILLLVFLVASVLICSSHAARILKVHEHEEAVAAALTADHHHQDSSSRSRSLLRELGYDDSKLKQYKKISSDRVAPGGPDPHHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31083		AtCLE5, CLE5, C...	CLAVATA3/ESR-RELATED 5 (.1)		Lus10002196 [exp]	0	1
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10027947 [exp]	2.8	0.7606
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10003345 [exp]	6.2	0.7562
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10013268 [exp]	7.5	0.7562
AT3G05950			RmlC-like cupins superfamily p...		Lus10035280 [exp]	8.7	0.7562
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10003585 [exp]	9.7	0.7562
AT3G04380		SDG31, SUVR4	SET DOMAIN PROTEIN 31, SET-dom...		Lus10005476 [exp]	10.4	0.7408
					Lus10014650 [exp]	11.2	0.7371
					Lus10027457 [exp]	12.3	0.7369
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10013134 [exp]	13.1	0.7314
AT4G24580		REN1	ROP1 ENHANCER 1, Rho GTPase ac...		Lus10005733 [exp]	14.5	0.7192

Compare expression of checked genes

Lus10002196 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.