Lus10002202 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51750 43 / 6e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003381 74 / 2e-16 AT4G17140 52 / 3e-07 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G103600 60 / 6e-12 AT3G51750 40 / 8e-05 unknown protein
PFAM info
Representative CDS sequence
>Lus10002202 pacid=23180540 polypeptide=Lus10002202 locus=Lus10002202.g ID=Lus10002202.BGIv1.0 annot-version=v1.0
ATGGAAGACTGTGCAATGGGAACTCCAGATATCTACCCAACCGACGACGTACTACAAGATCGCCGCCGTGAGGAAGAAGAGCAACATACCCCGGCTGCGG
TGGCGGCGGATGATCCAGTAGTGGTAGAGAGCAAAGATGAAGAGAAGAAAGGCGGGATCTTGAACAATCTCCTTGCCAACTTGGTTGCTCCTCTCAGCCC
AAGAGCCTCATCGCCGGAAGAAGATAAGGATCATCGCCGAGGAGCTTTCTCGAAGGATGCTACGTCACCGCCGCCGGCAGAGAAGGAAAGCGGAAATGGC
GGGATAATTGAGAACATTGTTTCCCACTTGCCCAAATCTCTCCCAGAAGATGTTGATCCGAGCAACGATGAGGCGTCAATTCTGATCCACGCCATTGTTC
ACGATTGA
AA sequence
>Lus10002202 pacid=23180540 polypeptide=Lus10002202 locus=Lus10002202.g ID=Lus10002202.BGIv1.0 annot-version=v1.0
MEDCAMGTPDIYPTDDVLQDRRREEEEQHTPAAVAADDPVVVESKDEEKKGGILNNLLANLVAPLSPRASSPEEDKDHRRGAFSKDATSPPPAEKESGNG
GIIENIVSHLPKSLPEDVDPSNDEASILIHAIVHD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G51750 unknown protein Lus10002202 0 1
AT1G69560 MYB LOF2, ATMYB105 LATERAL ORGAN FUSION 2, myb do... Lus10020309 6.8 0.7086
AT5G17800 MYB ATMYB56 myb domain protein 56 (.1) Lus10005683 13.1 0.6545
AT5G02440 unknown protein Lus10023770 18.9 0.6640
AT4G16650 O-fucosyltransferase family pr... Lus10028957 19.1 0.6443
AT3G14250 RING/U-box superfamily protein... Lus10000412 23.5 0.5908
AT5G47760 ATPK5, ATPGLP2 2-phosphoglycolate phosphatase... Lus10039102 25.9 0.5993
AT3G02870 VTC4 Inositol monophosphatase famil... Lus10039046 28.4 0.6451
AT1G28390 Protein kinase superfamily pro... Lus10039770 32.2 0.6391
AT5G19090 Heavy metal transport/detoxifi... Lus10004465 35.0 0.5869
AT4G38090 Ribosomal protein S5 domain 2-... Lus10025724 37.0 0.5702

Lus10002202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.