Lus10002203 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01580 237 / 5e-79 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT1G07080 199 / 2e-63 Thioredoxin superfamily protein (.1)
AT4G12900 169 / 2e-52 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12890 167 / 2e-51 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12870 155 / 8e-47 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 153 / 6e-46 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042270 207 / 1e-66 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10026384 206 / 3e-66 AT1G07080 281 / 1e-95 Thioredoxin superfamily protein (.1)
Lus10012503 163 / 6e-50 AT1G07080 171 / 1e-52 Thioredoxin superfamily protein (.1)
Lus10022669 161 / 3e-49 AT1G07080 170 / 2e-52 Thioredoxin superfamily protein (.1)
Lus10022670 170 / 4e-49 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10012502 160 / 1e-45 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G121900 285 / 8e-98 AT5G01580 263 / 3e-89 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Potri.009G076200 201 / 1e-64 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.006G103000 193 / 3e-61 AT1G07080 196 / 3e-62 Thioredoxin superfamily protein (.1)
Potri.001G281004 189 / 5e-60 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
Potri.016G122200 187 / 4e-59 AT1G07080 204 / 3e-65 Thioredoxin superfamily protein (.1)
Potri.012G107300 187 / 1e-58 AT1G07080 205 / 1e-65 Thioredoxin superfamily protein (.1)
Potri.012G107600 186 / 1e-58 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.016G122000 180 / 1e-56 AT1G07080 185 / 3e-58 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Lus10002203 pacid=23180533 polypeptide=Lus10002203 locus=Lus10002203.g ID=Lus10002203.BGIv1.0 annot-version=v1.0
ATGGATTCTCGTTCCTTCCTCTTAGCTTGTACCCTGACAATGGCCGCCATGGCCATTGCTTTACCTTCATCTTCTTCTGAAAACATCACTCTGTCTCTTT
ACTACGAAACCTTATGTCCGTACTGTGCAGATTTCATAGTGAACCATCTCCCCAAGGTGTTCGACAACGGGCTGATCTCGTTTCTCAATCTCAGGCTGAT
TCCTTGGGGCAATGCTCTTCTTCAACCTGACGGAACCTTCCTCTGCCAGCATGGTCCCAACGAATGCGTCCTGAATTCCATGGATGCCTGCACCATTGCA
ATTTACCCTGATCCAATTAGACATTTCAATTTCGTACGCTGCATCGAGATTCTTGTGATGGAGAACAAGCTAAACGACTGGATCGGTTGCTTTCAGGCCA
GTGGGTTGAGTGATGCGCCGGTTATTGATTGCTACACCAATGGCCTCGGGAAAGAGCTCGAGCGGCAACATGCTAGTGAAACTGGTGAGCTGAACCCACA
ACACAGGTTTGTGCCGTGGGTCGTTGTCAATGGCCAGCCACTCCAAGAGGATTTCAGCAACTTCCAAAGCTACATCTGCAAGGCTTACAGAGAAAGGTTC
GCTGATCAGGTGTTACCAAAAGTTTGCAATTCACTTCCAATGTCGAATTATTCGTTGAACGATGTCGAAGATTCGGTAAGCCAAAGTCGAGTTTGCCATC
CTCAAACAAACAGATGA
AA sequence
>Lus10002203 pacid=23180533 polypeptide=Lus10002203 locus=Lus10002203.g ID=Lus10002203.BGIv1.0 annot-version=v1.0
MDSRSFLLACTLTMAAMAIALPSSSSENITLSLYYETLCPYCADFIVNHLPKVFDNGLISFLNLRLIPWGNALLQPDGTFLCQHGPNECVLNSMDACTIA
IYPDPIRHFNFVRCIEILVMENKLNDWIGCFQASGLSDAPVIDCYTNGLGKELERQHASETGELNPQHRFVPWVVVNGQPLQEDFSNFQSYICKAYRERF
ADQVLPKVCNSLPMSNYSLNDVEDSVSQSRVCHPQTNR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G01580 OSH1 OAS HIGH ACCUMULATION 1, gamma... Lus10002203 0 1
AT2G32280 Protein of unknown function (D... Lus10038567 2.0 0.7485
AT1G31440 SH3 domain-containing protein ... Lus10034755 6.0 0.6724
AT4G01240 S-adenosyl-L-methionine-depend... Lus10010138 11.0 0.6540
AT5G13170 SAG29, SWEET15,... senescence-associated gene 29 ... Lus10043190 12.1 0.6419
AT5G18910 Protein kinase superfamily pro... Lus10012776 13.3 0.6301
AT2G38710 AMMECR1 family (.1.2) Lus10042783 17.3 0.6997
AT1G54830 CCAAT NF-YC3 "nuclear factor Y, subunit C3"... Lus10008013 20.7 0.5372
AT3G27950 GDSL-like Lipase/Acylhydrolase... Lus10008784 23.4 0.6230
AT2G38510 MATE efflux family protein (.1... Lus10025237 25.9 0.6663
AT1G27170 transmembrane receptors;ATP bi... Lus10014582 35.1 0.5849

Lus10002203 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.