Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43770 96 / 5e-26 Transducin/WD40 repeat-like superfamily protein (.1) AT3G49660 40 / 1e-05 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) AT5G64730 39 / 2e-05 Transducin/WD40 repeat-like superfamily protein (.1) AT5G08390 37 / 0.0001 Transducin/WD40 repeat-like superfamily protein (.1) AT4G02730 36 / 0.0004 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1) AT1G62020 35 / 0.0004 Coatomer, alpha subunit (.1) AT1G11160 35 / 0.0006 Transducin/WD40 repeat-like superfamily protein (.1) AT5G23430 35 / 0.0007 Transducin/WD40 repeat-like superfamily protein (.1.2) AT5G08560 35 / 0.0007 transducin family protein / WD-40 repeat family protein (.1.2) AT2G21390 35 / 0.0007 Coatomer, alpha subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003390 [exp] 100 / 2e-29 AT2G43770 236 / 6e-79 Transducin/WD40 repeat-like superfamily protein (.1) Lus10012230 [exp] 103 / 9e-29 AT2G43770 620 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10002860 [exp] 102 / 2e-28 AT2G43770 617 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10001410 [exp] 44 / 8e-07 AT5G08560 694 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Lus10001045 [exp] 41 / 7e-06 AT5G08560 694 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Lus10039636 [exp] 40 / 1e-05 AT3G49660 502 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) Lus10003487 [exp] 39 / 3e-05 AT3G49660 489 / 6e-176 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) Lus10001411 [exp] 36 / 0.0003 AT5G08560 695 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Lus10001046 [exp] 36 / 0.0003 AT5G08560 713 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G096900 [exp] 101 / 5e-28 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.005G148500 [exp] 41 / 5e-06 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) Potri.007G009500 [exp] 40 / 2e-05 AT3G49660 469 / 4e-168 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) Potri.005G206600 [exp] 37 / 0.0001 AT5G08560 736 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Potri.001G173500 [exp] 37 / 0.0001 AT1G15440 1342 / 0.0 \(PERIODIC TRYPTOPHAN PROTEIN 2, periodic tryptophan protein 2 (.1.2) Potri.002G055800 [exp] 37 / 0.0001 AT5G08560 716 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Potri.003G060500 [exp] 37 / 0.0002 AT1G15440 1349 / 0.0 \(PERIODIC TRYPTOPHAN PROTEIN 2, periodic tryptophan protein 2 (.1.2) Potri.002G051900 [exp] 36 / 0.0002 AT4G02730 524 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1) Potri.015G069700 [exp] 36 / 0.0004 AT1G62020 2100 / 0.0 Coatomer, alpha subunit (.1) Potri.012G074800 [exp] 36 / 0.0004 AT1G62020 2113 / 0.0 Coatomer, alpha subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10002211 pacid=23180536 polypeptide=Lus10002211 locus=Lus10002211.g ID=Lus10002211.BGIv1.0 annot-version=v1.0 ATGGTGTACATATGGGACACTACTTCGACAAGGATACTGTACAAGCTTCCGGGGCATACTGGGTCGGTTAACGAGTGCGTGTTTCACCCGACTGAACCGA TCATTGGATCGTGCGGCAGTGACAAGCAGATTTACCTTGGGGAGATTTGA
AA sequence Show only first row Show all	>Lus10002211 pacid=23180536 polypeptide=Lus10002211 locus=Lus10002211.g ID=Lus10002211.BGIv1.0 annot-version=v1.0 MVYIWDTTSTRILYKLPGHTGSVNECVFHPTEPIIGSCGSDKQIYLGEI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43770			Transducin/WD40 repeat-like su...		Lus10002211 [exp]	0	1
AT2G32070			Polynucleotidyl transferase, r...		Lus10003635 [exp]	2.8	0.8505
AT3G10110		MEE67	maternal effect embryo arrest ...		Lus10020223 [exp]	4.2	0.8033
AT1G13410			Tetratricopeptide repeat (TPR)...		Lus10021069 [exp]	4.7	0.8486
AT1G62730			Terpenoid synthases superfamil...		Lus10032248 [exp]	5.2	0.8223
AT5G47460			Pentatricopeptide repeat (PPR)...		Lus10007476 [exp]	5.5	0.7743
AT3G29230			Tetratricopeptide repeat (TPR)...		Lus10027455 [exp]	6.3	0.8051
AT5G27930			Protein phosphatase 2C family ...		Lus10029874 [exp]	7.9	0.7964
AT1G31830			Amino acid permease family pro...		Lus10007593 [exp]	8.2	0.8146
AT2G32070			Polynucleotidyl transferase, r...		Lus10036291 [exp]	9.4	0.7783
AT1G47820			unknown protein		Lus10031924 [exp]	12.0	0.7876

Compare expression of checked genes

Lus10002211 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.