Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04645 41 / 1e-05 Plant self-incompatibility protein S1 family (.1) AT5G04347 37 / 0.0004 Plant self-incompatibility protein S1 family (.1) AT1G11765 37 / 0.0004 Plant self-incompatibility protein S1 family (.1) AT3G16970 37 / 0.0006 Plant self-incompatibility protein S1 family (.1) AT5G12060 37 / 0.0007 Plant self-incompatibility protein S1 family (.1) AT4G16195 37 / 0.0008 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023195 [exp] 159 / 6e-52 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10023193 [exp] 137 / 1e-43 ND 37 / 6e-04 Lus10023196 [exp] 135 / 1e-42 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1) Lus10023025 [exp] 133 / 8e-42 ND 39 / 1e-04 Lus10023194 [exp] 130 / 2e-40 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1) Lus10002747 [exp] 87 / 1e-23 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10016329 [exp] 81 / 7e-21 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10016330 [exp] 76 / 7e-19 AT1G11765 47 / 2e-07 Plant self-incompatibility protein S1 family (.1) Lus10018785 [exp] 71 / 6e-17 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 63 / 8e-14 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.010G008300 [exp] 52 / 9e-10 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 45 / 5e-07 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.018G148630 [exp] 44 / 1e-06 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 41 / 8e-06 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 40 / 5e-05 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.017G144361 [exp] 39 / 9e-05 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1) Potri.001G053100 [exp] 38 / 0.0002 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 37 / 0.0005 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.018G148700 [exp] 37 / 0.0007 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10002219 pacid=23169468 polypeptide=Lus10002219 locus=Lus10002219.g ID=Lus10002219.BGIv1.0 annot-version=v1.0 ATGCACATCTTCAACGACGTAAGCTTGGAGTTGATAGTGCATTGCCAATCGGGGGATACGGATCTTGGTGCCCGAGTTGTTCCTGTTAAGTCGGAGTTCA GCTGGAGTTTTACGGCGTACAGCTTCACACTTTTTTGGTGCAATGTAGCCGTACAAGATAAACGAGTTCATTTTGACGCCTACGATGGTGAAGCAGAATG CCCGTTTCACTATCTGGTCAATGATACTGGGGTTTATGTCGATGAACCTGGATGTAACCCTAAGCATTATCCGTGGCCTCAATTTTAA
AA sequence Show only first row Show all	>Lus10002219 pacid=23169468 polypeptide=Lus10002219 locus=Lus10002219.g ID=Lus10002219.BGIv1.0 annot-version=v1.0 MHIFNDVSLELIVHCQSGDTDLGARVVPVKSEFSWSFTAYSFTLFWCNVAVQDKRVHFDAYDGEAECPFHYLVNDTGVYVDEPGCNPKHYPWPQF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04645			Plant self-incompatibility pro...		Lus10002219 [exp]	0	1
					Lus10005830 [exp]	1.0	1.0000
					Lus10009618 [exp]	1.4	1.0000
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10013556 [exp]	2.0	1.0000
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10039085 [exp]	2.2	1.0000
AT4G03220			Protein with RNI-like/FBD-like...		Lus10023567 [exp]	2.4	1.0000
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10024077 [exp]	3.5	1.0000
					Lus10038463 [exp]	4.0	0.9998
AT2G43610			Chitinase family protein (.1)		Lus10001772 [exp]	4.2	0.9939
AT3G14880			unknown protein		Lus10013711 [exp]	4.5	0.9990
AT3G03000			EF hand calcium-binding protei...		Lus10004539 [exp]	4.9	0.9975

Compare expression of checked genes

Lus10002219 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.