Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019065 [exp] 47 / 2e-08 AT4G31985 100 / 2e-29 Ribosomal protein L39 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G112301 [exp] 42 / 5e-07 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.006G188500 [exp] 37 / 7e-05 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002220 pacid=23169471 polypeptide=Lus10002220 locus=Lus10002220.g ID=Lus10002220.BGIv1.0 annot-version=v1.0 ATGTATTTTCTTCCCGTCGCACAAGTCGTTCATGATCAAGAAGAAGCTGGCGAAGAAGATGAGGCAGAACAGGCCGATACCGTATTGGATCAGGATGAGG ACGGACAACACCATCAGGTACAATGCGAAGCGCAGGCACTGGCGCCGCACCAAGCTAGGGTTCTAAGCTGCTCAGAGGTTGGATTACGGATGAGTTAA
AA sequence Show only first row Show all	>Lus10002220 pacid=23169471 polypeptide=Lus10002220 locus=Lus10002220.g ID=Lus10002220.BGIv1.0 annot-version=v1.0 MYFLPVAQVVHDQEEAGEEDEAEQADTVLDQDEDGQHHQVQCEAQALAPHQARVLSCSEVGLRMS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002220 [exp]	0	1
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Lus10040718 [exp]	4.0	0.7875
AT1G16830			Pentatricopeptide repeat (PPR)...		Lus10015181 [exp]	12.8	0.7591
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10021027 [exp]	33.7	0.7498
AT5G60670			Ribosomal protein L11 family p...		Lus10015085 [exp]	36.9	0.7361
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Lus10016453 [exp]	39.3	0.7415
AT5G48760			Ribosomal protein L13 family p...		Lus10022793 [exp]	41.0	0.7147
AT5G27850			Ribosomal protein L18e/L15 sup...		Lus10029879 [exp]	42.8	0.7171
AT3G10350			P-loop containing nucleoside t...		Lus10021449 [exp]	51.8	0.6250
AT5G48760			Ribosomal protein L13 family p...		Lus10011857 [exp]	54.4	0.7238
AT1G14810			semialdehyde dehydrogenase fam...		Lus10013239 [exp]	59.1	0.7038

Compare expression of checked genes

Lus10002220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.