Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37210 378 / 2e-135 LOG3 LONELY GUY 3, lysine decarboxylase family protein (.1.2) AT2G28305 366 / 2e-130 ATLOG1 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) AT3G53450 366 / 2e-130 LOG4 LONELY GUY 4, Putative lysine decarboxylase family protein (.1) AT5G06300 334 / 9e-118 LOG7 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) AT2G35990 312 / 4e-109 LOG2 LONELY GUY 2, Putative lysine decarboxylase family protein (.1.2.3) AT4G35190 308 / 3e-107 LOG5 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) AT5G11950 282 / 3e-97 LOG8 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) AT5G03270 267 / 3e-91 LOG6 LONELY GUY 6, lysine decarboxylase family protein (.1) AT5G26140 155 / 3e-48 ATLOG9 LONELY GUY 9, Putative lysine decarboxylase family protein (.1) AT1G50575 44 / 4e-05 Putative lysine decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023190 [exp] 434 / 2e-157 AT2G37210 364 / 6e-130 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10026513 [exp] 400 / 1e-143 AT2G37210 394 / 1e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10021462 [exp] 368 / 3e-131 AT2G28305 386 / 1e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10016096 [exp] 366 / 2e-130 AT2G28305 384 / 7e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10012436 [exp] 333 / 5e-117 AT5G06300 332 / 7e-117 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10024328 [exp] 325 / 6e-114 AT5G06300 328 / 2e-115 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10003335 [exp] 321 / 3e-112 AT4G35190 359 / 2e-127 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10022638 [exp] 319 / 1e-111 AT4G35190 365 / 2e-129 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10025117 [exp] 319 / 2e-111 AT4G35190 373 / 1e-132 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G127400 [exp] 400 / 9e-144 AT2G37210 396 / 3e-142 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.016G090500 [exp] 396 / 2e-142 AT2G37210 392 / 8e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.009G010800 [exp] 368 / 3e-131 AT2G28305 359 / 8e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.004G212200 [exp] 367 / 4e-131 AT2G28305 361 / 1e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.005G237600 [exp] 338 / 3e-119 AT5G06300 338 / 2e-119 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.002G024000 [exp] 336 / 2e-118 AT2G37210 310 / 2e-108 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.002G012500 [exp] 330 / 5e-116 AT4G35190 300 / 5e-104 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.006G204800 [exp] 325 / 2e-114 AT5G06300 316 / 9e-111 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.005G248900 [exp] 322 / 9e-113 AT4G35190 297 / 7e-103 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.004G181800 [exp] 319 / 1e-111 AT4G35190 361 / 3e-128 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0349 [flax] [poplar] SLOG PF03641 [flax] [poplar] Lysine_decarbox Possible lysine decarboxylase
Representative CDS sequence Show only first row Show all	>Lus10002226 pacid=23169466 polypeptide=Lus10002226 locus=Lus10002226.g ID=Lus10002226.BGIv1.0 annot-version=v1.0 ATGCAAGAAGAGAGTGAAATTATTAGGCCATCTTCAAAGTTCAAGAGGATTTGTGTCTTCTGTGGGAGTAGTCAGGGCAAGAAAAGTAGCTATCAGGATG CTGCTATTCAGCTTGCCCATGAATTGGTTTCAAGGAACATCGATCTAGTGTATGGTGGGGGCAGCATAGGTCTGATGGGTTTGGTATCACAAGCAGTTCA TGATGGCGGGCGCCATGTTATTGGAGTTATTCCCAAGACGCTCATGCCTCGAGAGCTCACTGGGAAGACAGTGGGGGAAGTGAAGGCAGTTGCAGGGATG CATCAGAGGAAGGCAGAAATGGCTAAACATTCAGACGCCTTTATTGCTTTACCAGGTGGCTATGGGACCCTGGAAGAGTTGCTTGAAGTCATAACCTGGG CTCAACTTGGAATTCATGACAAACCAGTGGGACTGCTGAACGTGGATGGATACTACAATGCTTTACTCTCCTTCATTGACAAAGCCGTGGAAGAAGAATT CATCAGTCCTAGTGCCCGCTACATCATCGTCTCTGCACCTAATGCCAAGGAGTTGGTGAAGAAACTTGAGGATTATGTACCTTGCCACGAAAGGGTTGCT TCAAAACTGAACTGGGAAATAGAGCACCTGGGCTATGCGCAGAACTATGACATCTCTAGATGA
AA sequence Show only first row Show all	>Lus10002226 pacid=23169466 polypeptide=Lus10002226 locus=Lus10002226.g ID=Lus10002226.BGIv1.0 annot-version=v1.0 MQEESEIIRPSSKFKRICVFCGSSQGKKSSYQDAAIQLAHELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHVIGVIPKTLMPRELTGKTVGEVKAVAGM HQRKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNALLSFIDKAVEEEFISPSARYIIVSAPNAKELVKKLEDYVPCHERVA SKLNWEIEHLGYAQNYDISR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Lus10002226 [exp]	0	1
AT3G13480			unknown protein		Lus10010318 [exp]	2.2	0.8056
					Lus10043163 [exp]	3.5	0.7746
AT2G42570		TBL39	TRICHOME BIREFRINGENCE-LIKE 39...		Lus10000620 [exp]	6.2	0.7362
AT2G46690			SAUR-like auxin-responsive pro...		Lus10008845 [exp]	9.8	0.7721
AT3G16500	AUX_IAA	IAA26, PAP1	indole-3-acetic acid inducible...		Lus10006842 [exp]	12.6	0.7593
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Lus10023190 [exp]	13.0	0.7485
AT3G52770		ZPR3	LITTLE ZIPPER 3, protein bindi...		Lus10017055 [exp]	13.3	0.7401
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10021872 [exp]	14.3	0.7672
AT5G03260		LAC11	laccase 11 (.1)		Lus10013800 [exp]	16.2	0.7449
AT3G48260		WNK3	with no lysine (K) kinase 3 (....		Lus10041947 [exp]	21.7	0.7472

Compare expression of checked genes

Lus10002226 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.