Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42300 140 / 1e-45 UBL5 ubiquitin-like protein 5 (.1) AT3G45180 137 / 1e-44 Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023188 [exp] 148 / 9e-49 AT5G42300 140 / 1e-45 ubiquitin-like protein 5 (.1) Lus10019939 [exp] 144 / 3e-47 AT5G42300 141 / 5e-46 ubiquitin-like protein 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G223100 [exp] 143 / 9e-47 AT5G42300 144 / 2e-47 ubiquitin-like protein 5 (.1) Potri.008G039100 [exp] 141 / 5e-46 AT5G42300 147 / 2e-48 ubiquitin-like protein 5 (.1) Potri.004G211600 [exp] 140 / 8e-46 AT3G45180 143 / 1e-46 Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Lus10002228 pacid=23169467 polypeptide=Lus10002228 locus=Lus10002228.g ID=Lus10002228.BGIv1.0 annot-version=v1.0 ATGTTGGAAGTTGTGTTGAACGACAGGCTGGGGAAGAAGGTGAGGGTGAAGTGCAACGAAGATGACACCATCGGCGACCTCAAGAAGCTGGTGGCTGCGC AGACTGGAACCAAGGCCGAGAAGATTAGGATTCAGAAGTGGTACACCATCTACAAGGACCATATCACCCTTGGCGACTACGAGATTCACGACGGCATGGG CCTCGAGCTCTACTACAATTAA
AA sequence Show only first row Show all	>Lus10002228 pacid=23169467 polypeptide=Lus10002228 locus=Lus10002228.g ID=Lus10002228.BGIv1.0 annot-version=v1.0 MLEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTKAEKIRIQKWYTIYKDHITLGDYEIHDGMGLELYYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10002228 [exp]	0	1
AT1G15270			Translation machinery associat...		Lus10037543 [exp]	1.0	0.9316
AT5G07840		PIA1	phytochrome interacting ankyri...		Lus10033816 [exp]	2.0	0.9122
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10003977 [exp]	2.4	0.9092
AT3G45020			Ribosomal L18p/L5e family prot...		Lus10021433 [exp]	2.4	0.9082
AT1G25275			unknown protein		Lus10006792 [exp]	3.0	0.8981
AT5G07840		PIA1	phytochrome interacting ankyri...		Lus10018958 [exp]	4.5	0.9084
AT2G46080			unknown protein		Lus10036385 [exp]	4.5	0.9089
AT1G55340			Protein of unknown function (D...		Lus10010650 [exp]	4.9	0.8988
AT1G20225			Thioredoxin superfamily protei...		Lus10005616 [exp]	6.0	0.8687
AT5G11970			Protein of unknown function (D...		Lus10021581 [exp]	6.9	0.8961

Compare expression of checked genes

Lus10002228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.