Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37195 132 / 1e-40 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023187 [exp] 241 / 3e-83 AT2G37195 129 / 5e-39 unknown protein Lus10026508 [exp] 221 / 3e-76 AT2G37195 123 / 3e-37 unknown protein Lus10019937 [exp] 181 / 1e-59 AT2G37195 103 / 1e-28 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G090000 [exp] 211 / 4e-72 AT2G37195 132 / 8e-41 unknown protein Potri.006G127800 [exp] 209 / 1e-71 AT2G37195 134 / 1e-41 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002229 pacid=23169461 polypeptide=Lus10002229 locus=Lus10002229.g ID=Lus10002229.BGIv1.0 annot-version=v1.0 ATGGCCGGCGAGAGAAAGATGATCTTGGTGGGTTTGGTAGTGGCAATGCTTTTGGGGACTGCAGTTTACTTGAGGCTTTGGACCATTGACTACGCAATTT CCTCCGATGACACTGAGCTCATAAGAAGACAATTCGATCTGGCTAATAGAGAAGCCATGGATGAATCTGCAGAGTGGAGGATGAAGTATGATGAAGAGGC AGAAAGAGCAGCCAAGTGTGACAAGGAATTGATTGAGATCAAGCAGAATGTGGACGATGCTGCTAGTGTCAACCAACAGTTGTTGGTTCTGCAAAAGGAA AACATGTCCTTGATCAGACGAATGGAAGTATTGCAAAAGGAGCTGGCCGCTACCAGGTCAAAATGTCGCTCAAGATAG
AA sequence Show only first row Show all	>Lus10002229 pacid=23169461 polypeptide=Lus10002229 locus=Lus10002229.g ID=Lus10002229.BGIv1.0 annot-version=v1.0 MAGERKMILVGLVVAMLLGTAVYLRLWTIDYAISSDDTELIRRQFDLANREAMDESAEWRMKYDEEAERAAKCDKELIEIKQNVDDAASVNQQLLVLQKE NMSLIRRMEVLQKELAATRSKCRSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37195			unknown protein		Lus10002229 [exp]	0	1
AT1G05170			Galactosyltransferase family p...		Lus10002079 [exp]	4.5	0.8143
AT3G48040		ROP10, ARAC8, A...	Arabidopsis RAC-like 8, RHO-re...		Lus10033411 [exp]	7.1	0.7677
					Lus10008302 [exp]	13.0	0.8048
AT4G37300		MEE59	maternal effect embryo arrest ...		Lus10040706 [exp]	13.6	0.7923
AT2G45760		BAL, BAP2	BON ASSOCIATION PROTEIN 1-LIKE...		Lus10009818 [exp]	14.4	0.8028
AT4G28400			Protein phosphatase 2C family ...		Lus10040565 [exp]	15.6	0.8060
AT3G21810	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10015103 [exp]	18.8	0.7684
AT1G05170			Galactosyltransferase family p...		Lus10001148 [exp]	18.8	0.7815
AT1G54730			Major facilitator superfamily ...		Lus10029971 [exp]	22.5	0.7644
					Lus10034740 [exp]	23.0	0.7906

Compare expression of checked genes

Lus10002229 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.