Plant FIBer expression Database

Lus10002236 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25940 54 / 1e-10 early nodulin-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029566
[exp]
118 / 3e-36 ND /
Lus10043290
[exp]
63 / 7e-14 AT5G25940 76 / 3e-19 early nodulin-related (.1)
Lus10019434
[exp]
62 / 2e-13 AT5G25940 75 / 8e-19 early nodulin-related (.1)
Lus10030052
[exp]
42 / 8e-06 AT5G25940 74 / 3e-18 early nodulin-related (.1)
Lus10033027
[exp]
39 / 0.0001 AT5G25940 69 / 2e-16 early nodulin-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G033700
[exp]
92 / 6e-25 AT5G25940 68 / 1e-15 early nodulin-related (.1)
Potri.004G184000
[exp]
59 / 2e-12 AT5G25940 74 / 4e-18 early nodulin-related (.1)
Potri.009G143800
[exp]
39 / 0.0001 AT5G25940 65 / 1e-14 early nodulin-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03386 ENOD93 Early nodulin 93 ENOD93 protein
Representative CDS sequence
>Lus10002236 pacid=23172025 polypeptide=Lus10002236 locus=Lus10002236.g ID=Lus10002236.BGIv1.0 annot-version=v1.0
ATGGGGATTCCGTCCGATATGCGAGACTATTGGGCACAATCCATCGGAAGCAAGCGAAGCAGCTCCTTCGTGATTGCTTCTCCTGACGAGCAACGCAACA
AGGCTTTTGCTCAAGACAGCGTCATTGCTGGATTCAAAGCAGCTGTAGTGGCGGCCGTTCTCACCACTGGTCCTGTGATGGTTGCTTGTCGCAAGATTCC
CTGGGCAAAGAGGAACCTGAATTACGTAGCTCAAGCTCTCATCATATCTTCTGCTTCGATATCGACCTTCTTCATTACTGCTGACAAAACTACCTTGGAG
AGGGCGAGAAGCAACACTAAGTATGACAAAACAGTTTGA
AA sequence
>Lus10002236 pacid=23172025 polypeptide=Lus10002236 locus=Lus10002236.g ID=Lus10002236.BGIv1.0 annot-version=v1.0
MGIPSDMRDYWAQSIGSKRSSSFVIASPDEQRNKAFAQDSVIAGFKAAVVAAVLTTGPVMVACRKIPWAKRNLNYVAQALIISSASISTFFITADKTTLE
RARSNTKYDKTV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25940 early nodulin-related (.1) Lus10002236
[exp]
0 1
AT1G71840 transducin family protein / WD... Lus10031629
[exp]
5.2 0.9096
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10014627
[exp]
7.1 0.9058
AT2G35360 ubiquitin family protein (.1) Lus10004553
[exp]
8.1 0.8882
AT1G08830 CSD1 copper/zinc superoxide dismuta... Lus10004139
[exp]
8.4 0.9119
AT5G53560 B5#2, ATB5-A, A... ARABIDOPSIS CYTOCHROME B5 ISOF... Lus10008838
[exp]
8.8 0.9164
AT2G39840 TOPP4 type one serine/threonine prot... Lus10042559
[exp]
10.6 0.9021
AT4G14880 OLD3, CYTACS1, ... ONSET OF LEAF DEATH 3, O-acety... Lus10015947
[exp]
14.1 0.8994
AT3G47670 Plant invertase/pectin methyle... Lus10008625
[exp]
19.2 0.8825
AT4G11260 RPR1, ETA3, EDM... ENHANCER OF TIR1-1 AUXIN RESIS... Lus10027540
[exp]
21.4 0.8892
AT2G25670 unknown protein Lus10017738
[exp]
24.4 0.8980

Lus10002236 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.