Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58820 45 / 5e-07 Subtilisin-like serine endopeptidase family protein (.1) AT5G59120 43 / 3e-06 ATSBT4.13 subtilase 4.13 (.1) AT5G59110 40 / 3e-05 subtilisin-like serine protease-related (.1) AT5G59090 40 / 4e-05 ATSBT4.12 subtilase 4.12 (.1.2.3) AT5G59130 38 / 0.0003 Subtilase family protein (.1.2) AT2G04160 37 / 0.0003 AIR3 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) AT5G67360 37 / 0.0004 ARA12 Subtilase family protein (.1) AT1G01900 37 / 0.0006 SBTI1.1, ATSBT1.1 subtilase family protein (.1) AT4G00230 36 / 0.0008 XSP1 xylem serine peptidase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002244 [exp] 126 / 1e-35 AT5G67360 567 / 0.0 Subtilase family protein (.1) Lus10029576 [exp] 112 / 7e-33 AT5G67360 177 / 2e-51 Subtilase family protein (.1) Lus10029575 [exp] 115 / 9e-32 AT5G67360 552 / 0.0 Subtilase family protein (.1) Lus10006306 [exp] 114 / 2e-31 AT5G67360 555 / 0.0 Subtilase family protein (.1) Lus10029570 [exp] 114 / 2e-31 AT5G67360 550 / 0.0 Subtilase family protein (.1) Lus10006310 [exp] 113 / 5e-31 AT5G67360 542 / 0.0 Subtilase family protein (.1) Lus10002242 [exp] 112 / 2e-30 AT5G67360 555 / 0.0 Subtilase family protein (.1) Lus10006303 [exp] 103 / 2e-27 AT5G67360 563 / 0.0 Subtilase family protein (.1) Lus10006307 [exp] 99 / 7e-26 AT5G67360 532 / 2e-179 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G006570 [exp] 67 / 1e-14 AT1G04110 568 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118500 [exp] 66 / 4e-14 AT1G04110 557 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.001G113700 [exp] 62 / 7e-13 AT1G04110 538 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118800 [exp] 49 / 2e-08 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118700 [exp] 47 / 1e-07 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.014G074600 [exp] 47 / 2e-07 AT1G01900 788 / 0.0 subtilase family protein (.1) Potri.009G038001 [exp] 44 / 2e-06 AT3G46850 794 / 0.0 Subtilase family protein (.1) Potri.009G144500 [exp] 40 / 2e-05 AT5G59810 508 / 9e-170 Subtilase family protein (.1) Potri.014G171600 [exp] 39 / 7e-05 AT2G04160 986 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.004G184600 [exp] 39 / 0.0001 AT5G67360 399 / 5e-130 Subtilase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002245 pacid=23172016 polypeptide=Lus10002245 locus=Lus10002245.g ID=Lus10002245.BGIv1.0 annot-version=v1.0 ATGGCTGACTCGACCTACACAAGCAAGGAATTTCCACCAAATGGTATGGAAGTTAAAGTCACACCTAGTGAAATCAAGTTCAAGGAGCTAGAAGAGAAAG CAACATATTCCATAACATTCAGCAGACTGGGAAATGTGTCAGGACCTATAAGCCAAGGTTCCTTGGTGTGGTCATCAGCTGATGCTCGCTACAATGTCGT GAGCACAATTGCTGTGGTATTTGTTTGA
AA sequence Show only first row Show all	>Lus10002245 pacid=23172016 polypeptide=Lus10002245 locus=Lus10002245.g ID=Lus10002245.BGIv1.0 annot-version=v1.0 MADSTYTSKEFPPNGMEVKVTPSEIKFKELEEKATYSITFSRLGNVSGPISQGSLVWSSADARYNVVSTIAVVFV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58820			Subtilisin-like serine endopep...		Lus10002245 [exp]	0	1
AT4G37110			Zinc-finger domain of monoamin...		Lus10021004 [exp]	3.7	0.7453
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10001493 [exp]	7.5	0.7561
AT1G11410			S-locus lectin protein kinase ...		Lus10007610 [exp]	10.5	0.7002
					Lus10015336 [exp]	15.6	0.6962
					Lus10024012 [exp]	16.0	0.6922
					Lus10027076 [exp]	21.5	0.6725
AT4G26830			O-Glycosyl hydrolases family 1...		Lus10011852 [exp]	25.0	0.6095
AT2G47770		ATTSPO	TSPO(outer membrane tryptophan...		Lus10037513 [exp]	25.2	0.5613
AT1G14590			Nucleotide-diphospho-sugar tra...		Lus10041976 [exp]	27.2	0.6502
					Lus10001078 [exp]	36.5	0.6179

Compare expression of checked genes

Lus10002245 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.